Anti ZNF783 pAb (ATL-HPA020375)

Atlas Antibodies

Catalog No.: ATL-HPA020375-25

Protein Description: zinc finger family member 783
Gene Name: ZNF783
Alternative Gene Name: DKFZp667J212
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052763: 49%, ENSRNOG00000006711: 51%
Entrez Gene ID: 100289678
Uniprot ID: Q6ZMS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEAAPARDPETDKHTEDQSPSTPLPQPAAEKNSYLYSTEITLWTVVAAIQALEKKVDSCLTRLLTL
• Gene Sequence: MAEAAPARDPETDKHTEDQSPSTPLPQPAAEKNSYLYSTEITLWTVVAAIQALEKKVDSCLTRLLTL
• Gene ID - Mouse: ENSMUSG00000052763
• Gene ID - Rat: ENSRNOG00000006711
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.