Anti ZNF776 pAb (ATL-HPA046653)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046653-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZNF776
Alternative Gene Name: FLJ38288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062040: 38%, ENSRNOG00000047627: 38%
Entrez Gene ID: 284309
Uniprot ID: Q68DI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLQQEDIHTSGKSNFETKHGIPLQGGKTHYICGESTIPFSNKHSLVLHQRLLPREGPYVCSDSGKFTSKS |
Gene Sequence | LLQQEDIHTSGKSNFETKHGIPLQGGKTHYICGESTIPFSNKHSLVLHQRLLPREGPYVCSDSGKFTSKS |
Gene ID - Mouse | ENSMUSG00000062040 |
Gene ID - Rat | ENSRNOG00000047627 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF776 pAb (ATL-HPA046653) | |
Datasheet | Anti ZNF776 pAb (ATL-HPA046653) Datasheet (External Link) |
Vendor Page | Anti ZNF776 pAb (ATL-HPA046653) at Atlas Antibodies |
Documents & Links for Anti ZNF776 pAb (ATL-HPA046653) | |
Datasheet | Anti ZNF776 pAb (ATL-HPA046653) Datasheet (External Link) |
Vendor Page | Anti ZNF776 pAb (ATL-HPA046653) |