Anti ZNF776 pAb (ATL-HPA046653)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046653-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ZNF776
Alternative Gene Name: FLJ38288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062040: 38%, ENSRNOG00000047627: 38%
Entrez Gene ID: 284309
Uniprot ID: Q68DI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLQQEDIHTSGKSNFETKHGIPLQGGKTHYICGESTIPFSNKHSLVLHQRLLPREGPYVCSDSGKFTSKS |
| Gene Sequence | LLQQEDIHTSGKSNFETKHGIPLQGGKTHYICGESTIPFSNKHSLVLHQRLLPREGPYVCSDSGKFTSKS |
| Gene ID - Mouse | ENSMUSG00000062040 |
| Gene ID - Rat | ENSRNOG00000047627 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF776 pAb (ATL-HPA046653) | |
| Datasheet | Anti ZNF776 pAb (ATL-HPA046653) Datasheet (External Link) |
| Vendor Page | Anti ZNF776 pAb (ATL-HPA046653) at Atlas Antibodies |
| Documents & Links for Anti ZNF776 pAb (ATL-HPA046653) | |
| Datasheet | Anti ZNF776 pAb (ATL-HPA046653) Datasheet (External Link) |
| Vendor Page | Anti ZNF776 pAb (ATL-HPA046653) |