Anti ZNF776 pAb (ATL-HPA046653)

Atlas Antibodies

Catalog No.:
ATL-HPA046653-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 776
Gene Name: ZNF776
Alternative Gene Name: FLJ38288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062040: 38%, ENSRNOG00000047627: 38%
Entrez Gene ID: 284309
Uniprot ID: Q68DI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLQQEDIHTSGKSNFETKHGIPLQGGKTHYICGESTIPFSNKHSLVLHQRLLPREGPYVCSDSGKFTSKS
Gene Sequence LLQQEDIHTSGKSNFETKHGIPLQGGKTHYICGESTIPFSNKHSLVLHQRLLPREGPYVCSDSGKFTSKS
Gene ID - Mouse ENSMUSG00000062040
Gene ID - Rat ENSRNOG00000047627
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF776 pAb (ATL-HPA046653)
Datasheet Anti ZNF776 pAb (ATL-HPA046653) Datasheet (External Link)
Vendor Page Anti ZNF776 pAb (ATL-HPA046653) at Atlas Antibodies

Documents & Links for Anti ZNF776 pAb (ATL-HPA046653)
Datasheet Anti ZNF776 pAb (ATL-HPA046653) Datasheet (External Link)
Vendor Page Anti ZNF776 pAb (ATL-HPA046653)