Anti ZNF746 pAb (ATL-HPA020272)

Atlas Antibodies

Catalog No.:
ATL-HPA020272-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 746
Gene Name: ZNF746
Alternative Gene Name: FLJ31413
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057691: 95%, ENSRNOG00000007064: 94%
Entrez Gene ID: 155061
Uniprot ID: Q6NUN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHP
Gene Sequence WNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHP
Gene ID - Mouse ENSMUSG00000057691
Gene ID - Rat ENSRNOG00000007064
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF746 pAb (ATL-HPA020272)
Datasheet Anti ZNF746 pAb (ATL-HPA020272) Datasheet (External Link)
Vendor Page Anti ZNF746 pAb (ATL-HPA020272) at Atlas Antibodies

Documents & Links for Anti ZNF746 pAb (ATL-HPA020272)
Datasheet Anti ZNF746 pAb (ATL-HPA020272) Datasheet (External Link)
Vendor Page Anti ZNF746 pAb (ATL-HPA020272)