Anti ZNF746 pAb (ATL-HPA020272)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020272-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF746
Alternative Gene Name: FLJ31413
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057691: 95%, ENSRNOG00000007064: 94%
Entrez Gene ID: 155061
Uniprot ID: Q6NUN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHP |
| Gene Sequence | WNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHP |
| Gene ID - Mouse | ENSMUSG00000057691 |
| Gene ID - Rat | ENSRNOG00000007064 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF746 pAb (ATL-HPA020272) | |
| Datasheet | Anti ZNF746 pAb (ATL-HPA020272) Datasheet (External Link) |
| Vendor Page | Anti ZNF746 pAb (ATL-HPA020272) at Atlas Antibodies |
| Documents & Links for Anti ZNF746 pAb (ATL-HPA020272) | |
| Datasheet | Anti ZNF746 pAb (ATL-HPA020272) Datasheet (External Link) |
| Vendor Page | Anti ZNF746 pAb (ATL-HPA020272) |