Anti ZNF709 pAb (ATL-HPA053153)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053153-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF709
Alternative Gene Name: FLJ38281
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079620: 44%, ENSRNOG00000024365: 38%
Entrez Gene ID: 163051
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQSLSAVTSSDQRRRSKEARTPGTRDTDSVVFED |
Gene Sequence | LQSLSAVTSSDQRRRSKEARTPGTRDTDSVVFED |
Gene ID - Mouse | ENSMUSG00000079620 |
Gene ID - Rat | ENSRNOG00000024365 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF709 pAb (ATL-HPA053153) | |
Datasheet | Anti ZNF709 pAb (ATL-HPA053153) Datasheet (External Link) |
Vendor Page | Anti ZNF709 pAb (ATL-HPA053153) at Atlas Antibodies |
Documents & Links for Anti ZNF709 pAb (ATL-HPA053153) | |
Datasheet | Anti ZNF709 pAb (ATL-HPA053153) Datasheet (External Link) |
Vendor Page | Anti ZNF709 pAb (ATL-HPA053153) |