Anti ZNF709 pAb (ATL-HPA053153)

Atlas Antibodies

Catalog No.:
ATL-HPA053153-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 709
Gene Name: ZNF709
Alternative Gene Name: FLJ38281
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079620: 44%, ENSRNOG00000024365: 38%
Entrez Gene ID: 163051
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQSLSAVTSSDQRRRSKEARTPGTRDTDSVVFED
Gene Sequence LQSLSAVTSSDQRRRSKEARTPGTRDTDSVVFED
Gene ID - Mouse ENSMUSG00000079620
Gene ID - Rat ENSRNOG00000024365
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF709 pAb (ATL-HPA053153)
Datasheet Anti ZNF709 pAb (ATL-HPA053153) Datasheet (External Link)
Vendor Page Anti ZNF709 pAb (ATL-HPA053153) at Atlas Antibodies

Documents & Links for Anti ZNF709 pAb (ATL-HPA053153)
Datasheet Anti ZNF709 pAb (ATL-HPA053153) Datasheet (External Link)
Vendor Page Anti ZNF709 pAb (ATL-HPA053153)