Anti ZNF695 pAb (ATL-HPA024743)

Atlas Antibodies

Catalog No.:
ATL-HPA024743-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 695
Gene Name: ZNF695
Alternative Gene Name: SBZF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071291: 55%, ENSRNOG00000037556: 54%
Entrez Gene ID: 57116
Uniprot ID: Q8IW36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GENPYQCKKCGKAFNECSCFTDCKRIHVGEKHCKCEECNNIFKSCSSLAVVEKNHTEKKTYRCEE
Gene Sequence GENPYQCKKCGKAFNECSCFTDCKRIHVGEKHCKCEECNNIFKSCSSLAVVEKNHTEKKTYRCEE
Gene ID - Mouse ENSMUSG00000071291
Gene ID - Rat ENSRNOG00000037556
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF695 pAb (ATL-HPA024743)
Datasheet Anti ZNF695 pAb (ATL-HPA024743) Datasheet (External Link)
Vendor Page Anti ZNF695 pAb (ATL-HPA024743) at Atlas Antibodies

Documents & Links for Anti ZNF695 pAb (ATL-HPA024743)
Datasheet Anti ZNF695 pAb (ATL-HPA024743) Datasheet (External Link)
Vendor Page Anti ZNF695 pAb (ATL-HPA024743)