Anti ZNF665 pAb (ATL-HPA023437)

Atlas Antibodies

Catalog No.:
ATL-HPA023437-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 665
Gene Name: ZNF665
Alternative Gene Name: FLJ14345
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028656: 25%, ENSRNOG00000030938: 26%
Entrez Gene ID: 79788
Uniprot ID: Q9H7R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSLDISCKCVNTDLPPKGKNNMGEAFYTVKLERLESCDTVGLSFQEVQKNTYDFECQWKDD
Gene Sequence VSLDISCKCVNTDLPPKGKNNMGEAFYTVKLERLESCDTVGLSFQEVQKNTYDFECQWKDD
Gene ID - Mouse ENSMUSG00000028656
Gene ID - Rat ENSRNOG00000030938
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF665 pAb (ATL-HPA023437)
Datasheet Anti ZNF665 pAb (ATL-HPA023437) Datasheet (External Link)
Vendor Page Anti ZNF665 pAb (ATL-HPA023437) at Atlas Antibodies

Documents & Links for Anti ZNF665 pAb (ATL-HPA023437)
Datasheet Anti ZNF665 pAb (ATL-HPA023437) Datasheet (External Link)
Vendor Page Anti ZNF665 pAb (ATL-HPA023437)