Anti ZNF623 pAb (ATL-HPA044372)

Atlas Antibodies

Catalog No.: ATL-HPA044372-25

Protein Description: zinc finger protein 623
Gene Name: ZNF623
Alternative Gene Name: KIAA0628
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021087: 31%, ENSRNOG00000009302: 29%
Entrez Gene ID: 9831
Uniprot ID: O75123
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MILLSFVSDSNVGTGEKKVTEAWISEDENSHRTTSDRLTVMELPSPESEEVHEPRLGELLGNPEGQ
• Gene Sequence: MILLSFVSDSNVGTGEKKVTEAWISEDENSHRTTSDRLTVMELPSPESEEVHEPRLGELLGNPEGQ
• Gene ID - Mouse: ENSMUSG00000021087
• Gene ID - Rat: ENSRNOG00000009302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.