Anti ZNF609 pAb (ATL-HPA040742)

Atlas Antibodies

Catalog No.:
ATL-HPA040742-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 609
Gene Name: ZNF609
Alternative Gene Name: KIAA0295
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040524: 88%, ENSRNOG00000015977: 89%
Entrez Gene ID: 23060
Uniprot ID: O15014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGEGKVDSVKSKDAEQLVKEGAKKTLFPPQPQSKDSPYYQGFESYYSPSYAQSSPGALNPSSQAGVESQALKTKRDEEPESIEGKVKNDICEEKKPE
Gene Sequence DGEGKVDSVKSKDAEQLVKEGAKKTLFPPQPQSKDSPYYQGFESYYSPSYAQSSPGALNPSSQAGVESQALKTKRDEEPESIEGKVKNDICEEKKPE
Gene ID - Mouse ENSMUSG00000040524
Gene ID - Rat ENSRNOG00000015977
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF609 pAb (ATL-HPA040742)
Datasheet Anti ZNF609 pAb (ATL-HPA040742) Datasheet (External Link)
Vendor Page Anti ZNF609 pAb (ATL-HPA040742) at Atlas Antibodies

Documents & Links for Anti ZNF609 pAb (ATL-HPA040742)
Datasheet Anti ZNF609 pAb (ATL-HPA040742) Datasheet (External Link)
Vendor Page Anti ZNF609 pAb (ATL-HPA040742)