Anti ZNF606 pAb (ATL-HPA043584)

Atlas Antibodies

Catalog No.:
ATL-HPA043584-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 606
Gene Name: ZNF606
Alternative Gene Name: FLJ14260, KIAA1852, ZNF328
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030386: 82%, ENSRNOG00000019127: 77%
Entrez Gene ID: 80095
Uniprot ID: Q8WXB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WVRNLESKALIPAQSIFEEEQSHGMKLERYIWDDPWFSRLEVLGCKDQLEMYHMNQSTAMRQMVFMQKQV
Gene Sequence WVRNLESKALIPAQSIFEEEQSHGMKLERYIWDDPWFSRLEVLGCKDQLEMYHMNQSTAMRQMVFMQKQV
Gene ID - Mouse ENSMUSG00000030386
Gene ID - Rat ENSRNOG00000019127
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF606 pAb (ATL-HPA043584)
Datasheet Anti ZNF606 pAb (ATL-HPA043584) Datasheet (External Link)
Vendor Page Anti ZNF606 pAb (ATL-HPA043584) at Atlas Antibodies

Documents & Links for Anti ZNF606 pAb (ATL-HPA043584)
Datasheet Anti ZNF606 pAb (ATL-HPA043584) Datasheet (External Link)
Vendor Page Anti ZNF606 pAb (ATL-HPA043584)