Anti ZNF598 pAb (ATL-HPA041896)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041896-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ZNF598
Alternative Gene Name: FLJ00086
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041130: 86%, ENSRNOG00000012434: 86%
Entrez Gene ID: 90850
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEARFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVF |
| Gene Sequence | TTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEARFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVF |
| Gene ID - Mouse | ENSMUSG00000041130 |
| Gene ID - Rat | ENSRNOG00000012434 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF598 pAb (ATL-HPA041896) | |
| Datasheet | Anti ZNF598 pAb (ATL-HPA041896) Datasheet (External Link) |
| Vendor Page | Anti ZNF598 pAb (ATL-HPA041896) at Atlas Antibodies |
| Documents & Links for Anti ZNF598 pAb (ATL-HPA041896) | |
| Datasheet | Anti ZNF598 pAb (ATL-HPA041896) Datasheet (External Link) |
| Vendor Page | Anti ZNF598 pAb (ATL-HPA041896) |