Anti ZNF598 pAb (ATL-HPA041896)

Atlas Antibodies

Catalog No.: ATL-HPA041896-25

Protein Description: zinc finger protein 598
Gene Name: ZNF598
Alternative Gene Name: FLJ00086
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041130: 86%, ENSRNOG00000012434: 86%
Entrez Gene ID: 90850
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEARFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVF
• Gene Sequence: TTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEARFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVF
• Gene ID - Mouse: ENSMUSG00000041130
• Gene ID - Rat: ENSRNOG00000012434
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.