Anti ZNF587 pAb (ATL-HPA043288)

Atlas Antibodies

Catalog No.: ATL-HPA043288-25

Protein Description: zinc finger protein 587
Gene Name: ZNF587
Alternative Gene Name: FLJ14710, FLJ20813, UBF-fl, ZF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024104: 38%, ENSRNOG00000033573: 38%
Entrez Gene ID: 84914
Uniprot ID: Q96SQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDVLPSSGLCQEEAAVEKTDSETMHGPPFQEG
• Gene Sequence: KDVLPSSGLCQEEAAVEKTDSETMHGPPFQEG
• Gene ID - Mouse: ENSMUSG00000024104
• Gene ID - Rat: ENSRNOG00000033573
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.