Anti ZNF587 pAb (ATL-HPA043288)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043288-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF587
Alternative Gene Name: FLJ14710, FLJ20813, UBF-fl, ZF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024104: 38%, ENSRNOG00000033573: 38%
Entrez Gene ID: 84914
Uniprot ID: Q96SQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KDVLPSSGLCQEEAAVEKTDSETMHGPPFQEG |
| Gene Sequence | KDVLPSSGLCQEEAAVEKTDSETMHGPPFQEG |
| Gene ID - Mouse | ENSMUSG00000024104 |
| Gene ID - Rat | ENSRNOG00000033573 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF587 pAb (ATL-HPA043288) | |
| Datasheet | Anti ZNF587 pAb (ATL-HPA043288) Datasheet (External Link) |
| Vendor Page | Anti ZNF587 pAb (ATL-HPA043288) at Atlas Antibodies |
| Documents & Links for Anti ZNF587 pAb (ATL-HPA043288) | |
| Datasheet | Anti ZNF587 pAb (ATL-HPA043288) Datasheet (External Link) |
| Vendor Page | Anti ZNF587 pAb (ATL-HPA043288) |