Anti ZNF584 pAb (ATL-HPA043408)

Atlas Antibodies

Catalog No.:
ATL-HPA043408-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 584
Gene Name: ZNF584
Alternative Gene Name: FLJ39899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031907: 29%, ENSRNOG00000050651: 32%
Entrez Gene ID: 201514
Uniprot ID: Q8IVC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVSSLGLAPSRSPVFTQLEDDEQSWVPSWVDVTPVSRAEARRGFGLDGLCRVEDERAHP
Gene Sequence LVSSLGLAPSRSPVFTQLEDDEQSWVPSWVDVTPVSRAEARRGFGLDGLCRVEDERAHP
Gene ID - Mouse ENSMUSG00000031907
Gene ID - Rat ENSRNOG00000050651
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF584 pAb (ATL-HPA043408)
Datasheet Anti ZNF584 pAb (ATL-HPA043408) Datasheet (External Link)
Vendor Page Anti ZNF584 pAb (ATL-HPA043408) at Atlas Antibodies

Documents & Links for Anti ZNF584 pAb (ATL-HPA043408)
Datasheet Anti ZNF584 pAb (ATL-HPA043408) Datasheet (External Link)
Vendor Page Anti ZNF584 pAb (ATL-HPA043408)