Anti ZNF561 pAb (ATL-HPA055332)

Atlas Antibodies

Catalog No.:
ATL-HPA055332-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 561
Gene Name: ZNF561
Alternative Gene Name: MGC45408
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060510: 44%, ENSRNOG00000034037: 44%
Entrez Gene ID: 93134
Uniprot ID: Q8N587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVHKEASTGQELSKFNPCGKVFTLTPGLAVHLEVLN
Gene Sequence SVHKEASTGQELSKFNPCGKVFTLTPGLAVHLEVLN
Gene ID - Mouse ENSMUSG00000060510
Gene ID - Rat ENSRNOG00000034037
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF561 pAb (ATL-HPA055332)
Datasheet Anti ZNF561 pAb (ATL-HPA055332) Datasheet (External Link)
Vendor Page Anti ZNF561 pAb (ATL-HPA055332) at Atlas Antibodies

Documents & Links for Anti ZNF561 pAb (ATL-HPA055332)
Datasheet Anti ZNF561 pAb (ATL-HPA055332) Datasheet (External Link)
Vendor Page Anti ZNF561 pAb (ATL-HPA055332)