Anti ZNF551 pAb (ATL-HPA038187)

Atlas Antibodies

Catalog No.:
ATL-HPA038187-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 551
Gene Name: ZNF551
Alternative Gene Name: DKFZp686H1038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034071: 42%, ENSRNOG00000015271: 40%
Entrez Gene ID: 90233
Uniprot ID: Q7Z340
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NFAHVTSLGYCHGMENEAIASEQSVSIQVRTSKGNTPTQKTHLSEIKMCVPVL
Gene Sequence NFAHVTSLGYCHGMENEAIASEQSVSIQVRTSKGNTPTQKTHLSEIKMCVPVL
Gene ID - Mouse ENSMUSG00000034071
Gene ID - Rat ENSRNOG00000015271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF551 pAb (ATL-HPA038187)
Datasheet Anti ZNF551 pAb (ATL-HPA038187) Datasheet (External Link)
Vendor Page Anti ZNF551 pAb (ATL-HPA038187) at Atlas Antibodies

Documents & Links for Anti ZNF551 pAb (ATL-HPA038187)
Datasheet Anti ZNF551 pAb (ATL-HPA038187) Datasheet (External Link)
Vendor Page Anti ZNF551 pAb (ATL-HPA038187)