Anti ZNF502 pAb (ATL-HPA024761)

Atlas Antibodies

Catalog No.: ATL-HPA024761-25

Protein Description: zinc finger protein 502
Gene Name: ZNF502
Alternative Gene Name: FLJ12515, FLJ14855
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062234: 25%, ENSRNOG00000010967: 25%
Entrez Gene ID: 91392
Uniprot ID: Q8TBZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLNMQGAEERDIRRETCPGWVNKNKPALEQDVCKIDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAES
• Gene Sequence: MLNMQGAEERDIRRETCPGWVNKNKPALEQDVCKIDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAES
• Gene ID - Mouse: ENSMUSG00000062234
• Gene ID - Rat: ENSRNOG00000010967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.