Anti ZNF502 pAb (ATL-HPA024761)

Atlas Antibodies

Catalog No.:
ATL-HPA024761-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 502
Gene Name: ZNF502
Alternative Gene Name: FLJ12515, FLJ14855
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062234: 25%, ENSRNOG00000010967: 25%
Entrez Gene ID: 91392
Uniprot ID: Q8TBZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLNMQGAEERDIRRETCPGWVNKNKPALEQDVCKIDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAES
Gene Sequence MLNMQGAEERDIRRETCPGWVNKNKPALEQDVCKIDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAES
Gene ID - Mouse ENSMUSG00000062234
Gene ID - Rat ENSRNOG00000010967
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF502 pAb (ATL-HPA024761)
Datasheet Anti ZNF502 pAb (ATL-HPA024761) Datasheet (External Link)
Vendor Page Anti ZNF502 pAb (ATL-HPA024761) at Atlas Antibodies

Documents & Links for Anti ZNF502 pAb (ATL-HPA024761)
Datasheet Anti ZNF502 pAb (ATL-HPA024761) Datasheet (External Link)
Vendor Page Anti ZNF502 pAb (ATL-HPA024761)