Anti ZNF497 pAb (ATL-HPA047872)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047872-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF497
Alternative Gene Name: FLJ44773
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063663: 30%, ENSRNOG00000060662: 33%
Entrez Gene ID: 162968
Uniprot ID: Q6ZNH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PEEGQVLCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQGGPGRELGPADGGRDGAGPRSEPADRAL |
| Gene Sequence | PEEGQVLCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQGGPGRELGPADGGRDGAGPRSEPADRAL |
| Gene ID - Mouse | ENSMUSG00000063663 |
| Gene ID - Rat | ENSRNOG00000060662 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF497 pAb (ATL-HPA047872) | |
| Datasheet | Anti ZNF497 pAb (ATL-HPA047872) Datasheet (External Link) |
| Vendor Page | Anti ZNF497 pAb (ATL-HPA047872) at Atlas Antibodies |
| Documents & Links for Anti ZNF497 pAb (ATL-HPA047872) | |
| Datasheet | Anti ZNF497 pAb (ATL-HPA047872) Datasheet (External Link) |
| Vendor Page | Anti ZNF497 pAb (ATL-HPA047872) |