Anti ZNF420 pAb (ATL-HPA059675)

Atlas Antibodies

Catalog No.:
ATL-HPA059675-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 420
Gene Name: ZNF420
Alternative Gene Name: FLJ32191
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034216: 31%, ENSRNOG00000013689: 31%
Entrez Gene ID: 147923
Uniprot ID: Q8TAQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TAFLAGQQDRSDIYMSRRFTKSIFPVFFSVPTMWTSKLELRYSHGDFENGIWVLWIMEQKYRRSLQP
Gene Sequence TAFLAGQQDRSDIYMSRRFTKSIFPVFFSVPTMWTSKLELRYSHGDFENGIWVLWIMEQKYRRSLQP
Gene ID - Mouse ENSMUSG00000034216
Gene ID - Rat ENSRNOG00000013689
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF420 pAb (ATL-HPA059675)
Datasheet Anti ZNF420 pAb (ATL-HPA059675) Datasheet (External Link)
Vendor Page Anti ZNF420 pAb (ATL-HPA059675) at Atlas Antibodies

Documents & Links for Anti ZNF420 pAb (ATL-HPA059675)
Datasheet Anti ZNF420 pAb (ATL-HPA059675) Datasheet (External Link)
Vendor Page Anti ZNF420 pAb (ATL-HPA059675)