Anti ZNF407 pAb (ATL-HPA041673)

Atlas Antibodies

Catalog No.:
ATL-HPA041673-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 407
Gene Name: ZNF407
Alternative Gene Name: FLJ13839, FLJ20307, KIAA1703
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048410: 78%, ENSRNOG00000043357: 72%
Entrez Gene ID: 55628
Uniprot ID: Q9C0G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRKLDTLVTSEGLLEKLESTKNTLQAAHGNSVTSRPRPERNILVLGNSFRRRSSTFTLKGQAKKRFNLLGIKRGTSETQRMYMKHLR
Gene Sequence SRKLDTLVTSEGLLEKLESTKNTLQAAHGNSVTSRPRPERNILVLGNSFRRRSSTFTLKGQAKKRFNLLGIKRGTSETQRMYMKHLR
Gene ID - Mouse ENSMUSG00000048410
Gene ID - Rat ENSRNOG00000043357
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF407 pAb (ATL-HPA041673)
Datasheet Anti ZNF407 pAb (ATL-HPA041673) Datasheet (External Link)
Vendor Page Anti ZNF407 pAb (ATL-HPA041673) at Atlas Antibodies

Documents & Links for Anti ZNF407 pAb (ATL-HPA041673)
Datasheet Anti ZNF407 pAb (ATL-HPA041673) Datasheet (External Link)
Vendor Page Anti ZNF407 pAb (ATL-HPA041673)