Anti ZNF385B pAb (ATL-HPA046086)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046086-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZNF385B
Alternative Gene Name: FLJ25270, ZNF533
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027016: 88%, ENSRNOG00000019065: 87%
Entrez Gene ID: 151126
Uniprot ID: Q569K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQP |
Gene Sequence | GSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQP |
Gene ID - Mouse | ENSMUSG00000027016 |
Gene ID - Rat | ENSRNOG00000019065 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF385B pAb (ATL-HPA046086) | |
Datasheet | Anti ZNF385B pAb (ATL-HPA046086) Datasheet (External Link) |
Vendor Page | Anti ZNF385B pAb (ATL-HPA046086) at Atlas Antibodies |
Documents & Links for Anti ZNF385B pAb (ATL-HPA046086) | |
Datasheet | Anti ZNF385B pAb (ATL-HPA046086) Datasheet (External Link) |
Vendor Page | Anti ZNF385B pAb (ATL-HPA046086) |