Anti ZNF384 pAb (ATL-HPA004051 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004051-25

Protein Description: zinc finger protein 384
Gene Name: ZNF384
Alternative Gene Name: CAGH1A, CIZ, NMP4, NP, TNRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038346: 98%, ENSRNOG00000017066: 98%
Entrez Gene ID: 171017
Uniprot ID: Q8TF68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTA
• Gene Sequence: SHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTA
• Gene ID - Mouse: ENSMUSG00000038346
• Gene ID - Rat: ENSRNOG00000017066
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF384 pAb (ATL-HPA004051 w/enhanced validation) – 3 Found

Childress, Paul; Stayrook, Keith R; Alvarez, Marta B; Wang, Zhiping; Shao, Yu; Hernandez-Buquer, Selene; Mack, Justin K; Grese, Zachary R; He, Yongzheng; Horan, Daniel; Pavalko, Fredrick M; Warden, Stuart J; Robling, Alexander G; Yang, Feng-Chun; Allen, Matthew R; Krishnan, Venkatesh; Liu, Yunlong; Bidwell, Joseph P. Genome-Wide Mapping and Interrogation of the Nmp4 Antianabolic Bone Axis. Molecular Endocrinology (Baltimore, Md.). 2015;29(9):1269-85. 

He, Lifeng; Fan, Xiaoxiao; Li, Yirun; Chen, Mingming; Cui, Bin; Chen, Guoqiao; Dai, Yili; Zhou, Daizhan; Hu, Xiaotong; Lin, Hui. Overexpression of zinc finger protein 384 (ZNF 384), a poor prognostic predictor, promotes cell growth by upregulating the expression of Cyclin D1 in Hepatocellular carcinoma. Cell Death & Disease. 2019;10(6):444. 

Young, Sara K; Shao, Yu; Bidwell, Joseph P; Wek, Ronald C. Nuclear Matrix Protein 4 Is a Novel Regulator of Ribosome Biogenesis and Controls the Unfolded Protein Response via Repression of Gadd34 Expression. The Journal Of Biological Chemistry. 2016;291(26):13780-8.