Anti ZNF354C pAb (ATL-HPA030904)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030904-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ZNF354C
Alternative Gene Name: KID3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044807: 51%, ENSRNOG00000029205: 49%
Entrez Gene ID: 30832
Uniprot ID: Q86Y25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVSLGIPFSMPKLIHQLQQGEDPCMVEREVPSDTRLGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHWDINFEEAVEFE |
| Gene Sequence | LVSLGIPFSMPKLIHQLQQGEDPCMVEREVPSDTRLGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHWDINFEEAVEFE |
| Gene ID - Mouse | ENSMUSG00000044807 |
| Gene ID - Rat | ENSRNOG00000029205 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF354C pAb (ATL-HPA030904) | |
| Datasheet | Anti ZNF354C pAb (ATL-HPA030904) Datasheet (External Link) |
| Vendor Page | Anti ZNF354C pAb (ATL-HPA030904) at Atlas Antibodies |
| Documents & Links for Anti ZNF354C pAb (ATL-HPA030904) | |
| Datasheet | Anti ZNF354C pAb (ATL-HPA030904) Datasheet (External Link) |
| Vendor Page | Anti ZNF354C pAb (ATL-HPA030904) |