Anti ZNF341 pAb (ATL-HPA023240)

Atlas Antibodies

Catalog No.:
ATL-HPA023240-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 341
Gene Name: ZNF341
Alternative Gene Name: dJ553F4.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059842: 86%, ENSRNOG00000017086: 88%
Entrez Gene ID: 84905
Uniprot ID: Q9BYN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYPPLEVPNQCVEPPVYPTPTVYSPGKQGFKPKGPNPAAPMTSATGGTVATFDSPATLKTRRAKGARGLPEAAGKP
Gene Sequence PYPPLEVPNQCVEPPVYPTPTVYSPGKQGFKPKGPNPAAPMTSATGGTVATFDSPATLKTRRAKGARGLPEAAGKP
Gene ID - Mouse ENSMUSG00000059842
Gene ID - Rat ENSRNOG00000017086
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF341 pAb (ATL-HPA023240)
Datasheet Anti ZNF341 pAb (ATL-HPA023240) Datasheet (External Link)
Vendor Page Anti ZNF341 pAb (ATL-HPA023240) at Atlas Antibodies

Documents & Links for Anti ZNF341 pAb (ATL-HPA023240)
Datasheet Anti ZNF341 pAb (ATL-HPA023240) Datasheet (External Link)
Vendor Page Anti ZNF341 pAb (ATL-HPA023240)