Anti ZNF341 pAb (ATL-HPA023240)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023240-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ZNF341
Alternative Gene Name: dJ553F4.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059842: 86%, ENSRNOG00000017086: 88%
Entrez Gene ID: 84905
Uniprot ID: Q9BYN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PYPPLEVPNQCVEPPVYPTPTVYSPGKQGFKPKGPNPAAPMTSATGGTVATFDSPATLKTRRAKGARGLPEAAGKP |
| Gene Sequence | PYPPLEVPNQCVEPPVYPTPTVYSPGKQGFKPKGPNPAAPMTSATGGTVATFDSPATLKTRRAKGARGLPEAAGKP |
| Gene ID - Mouse | ENSMUSG00000059842 |
| Gene ID - Rat | ENSRNOG00000017086 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF341 pAb (ATL-HPA023240) | |
| Datasheet | Anti ZNF341 pAb (ATL-HPA023240) Datasheet (External Link) |
| Vendor Page | Anti ZNF341 pAb (ATL-HPA023240) at Atlas Antibodies |
| Documents & Links for Anti ZNF341 pAb (ATL-HPA023240) | |
| Datasheet | Anti ZNF341 pAb (ATL-HPA023240) Datasheet (External Link) |
| Vendor Page | Anti ZNF341 pAb (ATL-HPA023240) |