Anti ZNF326 pAb (ATL-HPA028466)

Atlas Antibodies

Catalog No.: ATL-HPA028466-25

Protein Description: zinc finger protein 326
Gene Name: ZNF326
Alternative Gene Name: FLJ20403, ZAN75, Zfp326, ZIRD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029290: 97%, ENSRNOG00000047761: 90%
Entrez Gene ID: 284695
Uniprot ID: Q5BKZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HMMKVETVHCSACSVYIPALHSSVQQHLKSPDHIKGKQAYKEQIKRESVLTATSILNNPIVKARYERFVKGENPFEIQDHSQDQQI
• Gene Sequence: HMMKVETVHCSACSVYIPALHSSVQQHLKSPDHIKGKQAYKEQIKRESVLTATSILNNPIVKARYERFVKGENPFEIQDHSQDQQI
• Gene ID - Mouse: ENSMUSG00000029290
• Gene ID - Rat: ENSRNOG00000047761
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.