Anti ZNF300 pAb (ATL-HPA051777)

Atlas Antibodies

SKU:
ATL-HPA051777-100
  • Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 300
Gene Name: ZNF300
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030302: 28%, ENSRNOG00000004026: 32%
Entrez Gene ID: 91975
Uniprot ID: Q96RE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSLCS
Gene Sequence EEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSLCS
Gene ID - Mouse ENSMUSG00000030302
Gene ID - Rat ENSRNOG00000004026
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF300 pAb (ATL-HPA051777)
Datasheet Anti ZNF300 pAb (ATL-HPA051777) Datasheet (External Link)
Vendor Page Anti ZNF300 pAb (ATL-HPA051777) at Atlas Antibodies

Documents & Links for Anti ZNF300 pAb (ATL-HPA051777)
Datasheet Anti ZNF300 pAb (ATL-HPA051777) Datasheet (External Link)
Vendor Page Anti ZNF300 pAb (ATL-HPA051777)