Anti ZNF260 pAb (ATL-HPA028806)

Atlas Antibodies

Catalog No.: ATL-HPA028806-25

Protein Description: zinc finger protein 260
Gene Name: ZNF260
Alternative Gene Name: ozrf1, Zfp260
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049421: 65%, ENSRNOG00000046867: 67%
Entrez Gene ID: 339324
Uniprot ID: Q3ZCT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MIGMLESLQHESDLLQHDQIHTGEKPYECNECRKTFSLKQNLVEHKKMHTGEKSH
• Gene Sequence: MIGMLESLQHESDLLQHDQIHTGEKPYECNECRKTFSLKQNLVEHKKMHTGEKSH
• Gene ID - Mouse: ENSMUSG00000049421
• Gene ID - Rat: ENSRNOG00000046867
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.