Anti ZNF26 pAb (ATL-HPA042406)

Atlas Antibodies

Catalog No.: ATL-HPA042406-25

Protein Description: zinc finger protein 26
Gene Name: ZNF26
Alternative Gene Name: FLJ20755, KOX20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022119: 29%, ENSRNOG00000009836: 29%
Entrez Gene ID: 7574
Uniprot ID: P17031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLGRLNLSKTHDSSRQRLYNTRGKSLTQNSAPSRSYLRKNPDKFHGYEEPYFLKHQRAHSIE
• Gene Sequence: VLGRLNLSKTHDSSRQRLYNTRGKSLTQNSAPSRSYLRKNPDKFHGYEEPYFLKHQRAHSIE
• Gene ID - Mouse: ENSMUSG00000022119
• Gene ID - Rat: ENSRNOG00000009836
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.