Anti ZNF26 pAb (ATL-HPA042406)

Atlas Antibodies

Catalog No.:
ATL-HPA042406-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 26
Gene Name: ZNF26
Alternative Gene Name: FLJ20755, KOX20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022119: 29%, ENSRNOG00000009836: 29%
Entrez Gene ID: 7574
Uniprot ID: P17031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLGRLNLSKTHDSSRQRLYNTRGKSLTQNSAPSRSYLRKNPDKFHGYEEPYFLKHQRAHSIE
Gene Sequence VLGRLNLSKTHDSSRQRLYNTRGKSLTQNSAPSRSYLRKNPDKFHGYEEPYFLKHQRAHSIE
Gene ID - Mouse ENSMUSG00000022119
Gene ID - Rat ENSRNOG00000009836
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF26 pAb (ATL-HPA042406)
Datasheet Anti ZNF26 pAb (ATL-HPA042406) Datasheet (External Link)
Vendor Page Anti ZNF26 pAb (ATL-HPA042406) at Atlas Antibodies

Documents & Links for Anti ZNF26 pAb (ATL-HPA042406)
Datasheet Anti ZNF26 pAb (ATL-HPA042406) Datasheet (External Link)
Vendor Page Anti ZNF26 pAb (ATL-HPA042406)