Anti ZNF248 pAb (ATL-HPA018237)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018237-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF248
Alternative Gene Name: bA162G10.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030145: 55%, ENSRNOG00000037251: 57%
Entrez Gene ID: 57209
Uniprot ID: Q8NDW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GQGFHDEAAFFTNKRSQIGETVCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFCMNLRFG |
| Gene Sequence | GQGFHDEAAFFTNKRSQIGETVCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFCMNLRFG |
| Gene ID - Mouse | ENSMUSG00000030145 |
| Gene ID - Rat | ENSRNOG00000037251 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF248 pAb (ATL-HPA018237) | |
| Datasheet | Anti ZNF248 pAb (ATL-HPA018237) Datasheet (External Link) |
| Vendor Page | Anti ZNF248 pAb (ATL-HPA018237) at Atlas Antibodies |
| Documents & Links for Anti ZNF248 pAb (ATL-HPA018237) | |
| Datasheet | Anti ZNF248 pAb (ATL-HPA018237) Datasheet (External Link) |
| Vendor Page | Anti ZNF248 pAb (ATL-HPA018237) |