Anti ZNF248 pAb (ATL-HPA018237)

Atlas Antibodies

Catalog No.:
ATL-HPA018237-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 248
Gene Name: ZNF248
Alternative Gene Name: bA162G10.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030145: 55%, ENSRNOG00000037251: 57%
Entrez Gene ID: 57209
Uniprot ID: Q8NDW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQGFHDEAAFFTNKRSQIGETVCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFCMNLRFG
Gene Sequence GQGFHDEAAFFTNKRSQIGETVCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFCMNLRFG
Gene ID - Mouse ENSMUSG00000030145
Gene ID - Rat ENSRNOG00000037251
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF248 pAb (ATL-HPA018237)
Datasheet Anti ZNF248 pAb (ATL-HPA018237) Datasheet (External Link)
Vendor Page Anti ZNF248 pAb (ATL-HPA018237) at Atlas Antibodies

Documents & Links for Anti ZNF248 pAb (ATL-HPA018237)
Datasheet Anti ZNF248 pAb (ATL-HPA018237) Datasheet (External Link)
Vendor Page Anti ZNF248 pAb (ATL-HPA018237)