Anti ZNF211 pAb (ATL-HPA049967)

Atlas Antibodies

Catalog No.: ATL-HPA049967-25

Protein Description: zinc finger protein 211
Gene Name: ZNF211
Alternative Gene Name: CH2H2-25, ZNF-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005267: 33%, ENSRNOG00000033624: 36%
Entrez Gene ID: 10520
Uniprot ID: Q13398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCIVHVSEKPFTCREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQ
• Gene Sequence: SCIVHVSEKPFTCREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQ
• Gene ID - Mouse: ENSMUSG00000005267
• Gene ID - Rat: ENSRNOG00000033624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.