Anti ZNF211 pAb (ATL-HPA049967)

Atlas Antibodies

Catalog No.:
ATL-HPA049967-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 211
Gene Name: ZNF211
Alternative Gene Name: CH2H2-25, ZNF-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005267: 33%, ENSRNOG00000033624: 36%
Entrez Gene ID: 10520
Uniprot ID: Q13398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCIVHVSEKPFTCREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQ
Gene Sequence SCIVHVSEKPFTCREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTLVQDQ
Gene ID - Mouse ENSMUSG00000005267
Gene ID - Rat ENSRNOG00000033624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF211 pAb (ATL-HPA049967)
Datasheet Anti ZNF211 pAb (ATL-HPA049967) Datasheet (External Link)
Vendor Page Anti ZNF211 pAb (ATL-HPA049967) at Atlas Antibodies

Documents & Links for Anti ZNF211 pAb (ATL-HPA049967)
Datasheet Anti ZNF211 pAb (ATL-HPA049967) Datasheet (External Link)
Vendor Page Anti ZNF211 pAb (ATL-HPA049967)