Anti ZNF114 pAb (ATL-HPA025019)

Atlas Antibodies

Catalog No.:
ATL-HPA025019-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 114
Gene Name: ZNF114
Alternative Gene Name: MGC17986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033722: 26%, ENSRNOG00000031208: 28%
Entrez Gene ID: 163071
Uniprot ID: Q8NC26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTC
Gene Sequence LPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTC
Gene ID - Mouse ENSMUSG00000033722
Gene ID - Rat ENSRNOG00000031208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF114 pAb (ATL-HPA025019)
Datasheet Anti ZNF114 pAb (ATL-HPA025019) Datasheet (External Link)
Vendor Page Anti ZNF114 pAb (ATL-HPA025019) at Atlas Antibodies

Documents & Links for Anti ZNF114 pAb (ATL-HPA025019)
Datasheet Anti ZNF114 pAb (ATL-HPA025019) Datasheet (External Link)
Vendor Page Anti ZNF114 pAb (ATL-HPA025019)