Anti ZMPSTE24 pAb (ATL-HPA006988)

Atlas Antibodies

Catalog No.: ATL-HPA006988-25

Protein Description: zinc metallopeptidase STE24
Gene Name: ZMPSTE24
Alternative Gene Name: FACE-1, HGPS, PRO1, STE24, Ste24p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043207: 88%, ENSRNOG00000012054: 94%
Entrez Gene ID: 10269
Uniprot ID: O75844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS
• Gene Sequence: KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS
• Gene ID - Mouse: ENSMUSG00000043207
• Gene ID - Rat: ENSRNOG00000012054
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.