Anti ZKSCAN1 pAb (ATL-HPA006672)

Atlas Antibodies

Catalog No.: ATL-HPA006672-25

Protein Description: zinc finger with KRAB and SCAN domains 1
Gene Name: ZKSCAN1
Alternative Gene Name: KOX18, PHZ-37, ZNF139, ZNF36, ZSCAN33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029729: 73%, ENSRNOG00000001335: 72%
Entrez Gene ID: 7586
Uniprot ID: P17029
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR
• Gene Sequence: NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR
• Gene ID - Mouse: ENSMUSG00000029729
• Gene ID - Rat: ENSRNOG00000001335
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZKSCAN1 pAb (ATL-HPA006672) – 1 Found

Dhara, S; Chhangawala, S; Chintalapudi, H; Askan, G; Aveson, V; Massa, A L; Zhang, L; Torres, D; Makohon-Moore, A P; Lecomte, N; Melchor, J P; Bermeo, J; Cardenas, A 3rd; Sinha, S; Glassman, D; Nicolle, R; Moffitt, R; Yu, K H; Leppanen, S; Laderman, S; Curry, B; Gui, J; Balachandran, V P; Iacobuzio-Donahue, C; Chandwani, R; Leslie, C S; Leach, S D. Pancreatic cancer prognosis is predicted by an ATAC-array technology for assessing chromatin accessibility. Nature Communications. 2021;12(1):3044.