Anti ZGRF1 pAb (ATL-HPA030704)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030704-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZGRF1
Alternative Gene Name: C4orf21, FLJ11331
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051278: 69%, ENSRNOG00000036980: 71%
Entrez Gene ID: 55345
Uniprot ID: Q86YA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CDGPKADRCKFFKWLEDVTPGYSTQEGARPGMVLSDIKSIGLYLRSQKIPLYEECQLLVRKGFDFQRKQYGKLKK |
| Gene Sequence | CDGPKADRCKFFKWLEDVTPGYSTQEGARPGMVLSDIKSIGLYLRSQKIPLYEECQLLVRKGFDFQRKQYGKLKK |
| Gene ID - Mouse | ENSMUSG00000051278 |
| Gene ID - Rat | ENSRNOG00000036980 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZGRF1 pAb (ATL-HPA030704) | |
| Datasheet | Anti ZGRF1 pAb (ATL-HPA030704) Datasheet (External Link) |
| Vendor Page | Anti ZGRF1 pAb (ATL-HPA030704) at Atlas Antibodies |
| Documents & Links for Anti ZGRF1 pAb (ATL-HPA030704) | |
| Datasheet | Anti ZGRF1 pAb (ATL-HPA030704) Datasheet (External Link) |
| Vendor Page | Anti ZGRF1 pAb (ATL-HPA030704) |