Anti ZFP91 pAb (ATL-HPA065325)

Atlas Antibodies

Catalog No.:
ATL-HPA065325-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ZFP91 zinc finger protein
Gene Name: ZFP91
Alternative Gene Name: PZF, ZNF757
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024695: 79%, ENSRNOG00000012524: 82%
Entrez Gene ID: 80829
Uniprot ID: Q96JP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SALPQEVSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDV
Gene Sequence SALPQEVSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDV
Gene ID - Mouse ENSMUSG00000024695
Gene ID - Rat ENSRNOG00000012524
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZFP91 pAb (ATL-HPA065325)
Datasheet Anti ZFP91 pAb (ATL-HPA065325) Datasheet (External Link)
Vendor Page Anti ZFP91 pAb (ATL-HPA065325) at Atlas Antibodies

Documents & Links for Anti ZFP91 pAb (ATL-HPA065325)
Datasheet Anti ZFP91 pAb (ATL-HPA065325) Datasheet (External Link)
Vendor Page Anti ZFP91 pAb (ATL-HPA065325)