Anti ZEB2 pAb (ATL-HPA003456 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003456-25

Protein Description: zinc finger E-box binding homeobox 2
Gene Name: ZEB2
Alternative Gene Name: KIAA0569, SIP-1, SIP1, ZFHX1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026872: 94%, ENSRNOG00000004677: 95%
Entrez Gene ID: 9839
Uniprot ID: O60315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
• Gene Sequence: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
• Gene ID - Mouse: ENSMUSG00000026872
• Gene ID - Rat: ENSRNOG00000004677
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZEB2 pAb (ATL-HPA003456 w/enhanced validation) – 12 Found

Denecker, G; Vandamme, N; Akay, O; Koludrovic, D; Taminau, J; Lemeire, K; Gheldof, A; De Craene, B; Van Gele, M; Brochez, L; Udupi, G M; Rafferty, M; Balint, B; Gallagher, W M; Ghanem, G; Huylebroeck, D; Haigh, J; van den Oord, J; Larue, L; Davidson, I; Marine, J-C; Berx, G. Identification of a ZEB2-MITF-ZEB1 transcriptional network that controls melanogenesis and melanoma progression. Cell Death And Differentiation. 2014;21(8):1250-61. 

Latil, Mathilde; Nassar, Dany; Beck, Benjamin; Boumahdi, Soufiane; Wang, Li; Brisebarre, Audrey; Dubois, Christine; Nkusi, Erwin; Lenglez, Sandrine; Checinska, Agnieszka; Vercauteren Drubbel, Alizée; Devos, Michael; Declercq, Wim; Yi, Rui; Blanpain, Cédric. Cell-Type-Specific Chromatin States Differentially Prime Squamous Cell Carcinoma Tumor-Initiating Cells for Epithelial to Mesenchymal Transition. Cell Stem Cell. 2017;20(2):191-204.e5. 

Liang, Zongwen; Chen, Yijie; Zhao, Yuan; Xu, Chaoyi; Zhang, Anqi; Zhang, Qiong; Wang, Danhan; He, Jing; Hua, Wenfeng; Duan, Ping. miR-200c suppresses endometriosis by targeting MALAT1 in vitro and in vivo. Stem Cell Research & Therapy. 2017;8(1):251. 

Puglisi, Rossella; Bellenghi, Maria; Pontecorvi, Giada; Gulino, Alessandro; Petrini, Marina; Felicetti, Federica; Bottero, Lisabianca; Mattia, Gianfranco; Carè, Alessandra. SCD5 restored expression favors differentiation and epithelial-mesenchymal reversion in advanced melanoma. Oncotarget. 2018;9(7):7567-7581. 

Kinchen, James; Chen, Hannah H; Parikh, Kaushal; Antanaviciute, Agne; Jagielowicz, Marta; Fawkner-Corbett, David; Ashley, Neil; Cubitt, Laura; Mellado-Gomez, Esther; Attar, Moustafa; Sharma, Eshita; Wills, Quin; Bowden, Rory; Richter, Felix C; Ahern, David; Puri, Kamal D; Henault, Jill; Gervais, Francois; Koohy, Hashem; Simmons, Alison. Structural Remodeling of the Human Colonic Mesenchyme in Inflammatory Bowel Disease. Cell. 2018;175(2):372-386.e17. 

Yang, Yi; Bae, Woo Kyun; Lee, Ji-Yoon; Choi, Yong Jae; Lee, Kyung Hwa; Park, Myong-Suk; Yu, Young Hyun; Park, So-Yeon; Zhou, Rui; Taş, İsa; Gamage, Chathurika; Paik, Man-Jeong; Lee, Jae Hyuk; Chung, Ik Joo; Kim, Kyung Keun; Hur, Jae-Seoun; Kim, Sang Kyum; Ha, Hyung-Ho; Kim, Hangun. Potassium usnate, a water-soluble usnic acid salt, shows enhanced bioavailability and inhibits invasion and metastasis in colorectal cancer. Scientific Reports. 2018;8(1):16234. 

Wensman, Helena; Göransson, Hanna; Leuchowius, Karl-Johan; Strömberg, Sara; Pontén, Fredrik; Isaksson, Anders; Rutteman, Gerard Roel; Heldin, Nils-Erik; Pejler, Gunnar; Hellmén, Eva. Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas. Breast Cancer Research And Treatment. 2009;118(2):333-43. 

Cai, Mu-Yan; Luo, Rong-Zhen; Chen, Jie-Wei; Pei, Xiao-Qing; Lu, Jia-Bin; Hou, Jing-Hui; Yun, Jing-Ping. Overexpression of ZEB2 in peritumoral liver tissue correlates with favorable survival after curative resection of hepatocellular carcinoma. Plos One. 7(2):e32838. 

Fang, Yong; Wei, Jinhuan; Cao, Jiazheng; Zhao, Hongwei; Liao, Bing; Qiu, Shaopeng; Wang, Daohu; Luo, Junhang; Chen, Wei. Protein expression of ZEB2 in renal cell carcinoma and its prognostic significance in patient survival. Plos One. 8(5):e62558. 

Sadłecki, Paweł; Jóźwicki, Jakub; Antosik, Paulina; Walentowicz-Sadłecka, Małgorzata. Expression of Selected Epithelial-Mesenchymal Transition Transcription Factors in Endometrial Cancer. Biomed Research International. 2020( 33457409):4584250. 

Solé-Boldo, Llorenç; Raddatz, Günter; Gutekunst, Julian; Gilliam, Oliver; Bormann, Felix; Liberio, Michelle S; Hasche, Daniel; Antonopoulos, Wiebke; Mallm, Jan-Philipp; Lonsdorf, Anke S; Rodríguez-Paredes, Manuel; Lyko, Frank. Differentiation-related epigenomic changes define clinically distinct keratinocyte cancer subclasses. Molecular Systems Biology. 2022;18(9):e11073. 

Jarrosson, Loraine; Dalle, Stéphane; Costechareyre, Clélia; Tang, Yaqi; Grimont, Maxime; Plaschka, Maud; Lacourrège, Marjorie; Teinturier, Romain; Le Bouar, Myrtille; Maucort-Boulch, Delphine; Eberhardt, Anaïs; Castellani, Valérie; Caramel, Julie; Delloye-Bourgeois, Céline. An in vivo avian model of human melanoma to perform rapid and robust preclinical studies. Embo Molecular Medicine. 2023;15(3):e16629.