Anti ZEB1 pAb (ATL-HPA027524 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027524-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ZEB1
Alternative Gene Name: AREB6, BZP, FECD6, NIL-2-A, PPCD3, TCF8, ZEB, Zfhep, Zfhx1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024238: 74%, ENSRNOG00000017863: 76%
Entrez Gene ID: 6935
Uniprot ID: P37275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST |
| Gene Sequence | EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST |
| Gene ID - Mouse | ENSMUSG00000024238 |
| Gene ID - Rat | ENSRNOG00000017863 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZEB1 pAb (ATL-HPA027524 w/enhanced validation) | |
| Datasheet | Anti ZEB1 pAb (ATL-HPA027524 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ZEB1 pAb (ATL-HPA027524 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ZEB1 pAb (ATL-HPA027524 w/enhanced validation) | |
| Datasheet | Anti ZEB1 pAb (ATL-HPA027524 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ZEB1 pAb (ATL-HPA027524 w/enhanced validation) |
| Citations for Anti ZEB1 pAb (ATL-HPA027524 w/enhanced validation) – 95 Found |
| Mock, Kerstin; Preca, Bogdan-Tiberius; Brummer, Tilman; Brabletz, Simone; Stemmler, Marc P; Brabletz, Thomas. The EMT-activator ZEB1 induces bone metastasis associated genes including BMP-inhibitors. Oncotarget. 2015;6(16):14399-412. PubMed |
| Asnaghi, Laura; Gezgin, Gülçin; Tripathy, Arushi; Handa, James T; Merbs, Shannath L; van der Velden, Pieter A; Jager, Martine J; Harbour, J William; Eberhart, Charles G. EMT-associated factors promote invasive properties of uveal melanoma cells. Molecular Vision. 21( 26321866):919-29. PubMed |
| Flanagan, L; Meyer, M; Fay, J; Curry, S; Bacon, O; Duessmann, H; John, K; Boland, K C; McNamara, D A; Kay, E W; Bantel, H; Schulze-Bergkamen, H; Prehn, J H M. Low levels of Caspase-3 predict favourable response to 5FU-based chemotherapy in advanced colorectal cancer: Caspase-3 inhibition as a therapeutic approach. Cell Death & Disease. 2016;7(2):e2087. PubMed |
| Singh, Shalini; Howell, Danielle; Trivedi, Niraj; Kessler, Ketty; Ong, Taren; Rosmaninho, Pedro; Raposo, Alexandre Asf; Robinson, Giles; Roussel, Martine F; Castro, Diogo S; Solecki, David J. Zeb1 controls neuron differentiation and germinal zone exit by a mesenchymal-epithelial-like transition. Elife. 2016;5( 27178982) PubMed |
| Kim, Rae-Kwon; Kaushik, Neha; Suh, Yongjoon; Yoo, Ki-Chun; Cui, Yan-Hong; Kim, Min-Jung; Lee, Hae-June; Kim, In-Gyu; Lee, Su-Jae. Radiation driven epithelial-mesenchymal transition is mediated by Notch signaling in breast cancer. Oncotarget. 2016;7(33):53430-53442. PubMed |
| Montorsi, Lucia; Guizzetti, Filippo; Alecci, Claudia; Caporali, Andrea; Martello, Andrea; Atene, Claudio Giacinto; Parenti, Sandra; Pizzini, Silvia; Zanovello, Paola; Bortoluzzi, Stefania; Ferrari, Sergio; Grande, Alexis; Zanocco-Marani, Tommaso. Loss of ZFP36 expression in colorectal cancer correlates to wnt/ ß-catenin activity and enhances epithelial-to-mesenchymal transition through upregulation of ZEB1, SOX9 and MACC1. Oncotarget. 2016;7(37):59144-59157. PubMed |
| Koch, Katharina; Hartmann, Rudolf; Schröter, Friederike; Suwala, Abigail Kora; Maciaczyk, Donata; Krüger, Andrea Caroline; Willbold, Dieter; Kahlert, Ulf Dietrich; Maciaczyk, Jaroslaw. Reciprocal regulation of the cholinic phenotype and epithelial-mesenchymal transition in glioblastoma cells. Oncotarget. 2016;7(45):73414-73431. PubMed |
| Ball, Claudia R; Oppel, Felix; Ehrenberg, Karl Roland; Dubash, Taronish D; Dieter, Sebastian M; Hoffmann, Christopher M; Abel, Ulrich; Herbst, Friederike; Koch, Moritz; Werner, Jens; Bergmann, Frank; Ishaque, Naveed; Schmidt, Manfred; von Kalle, Christof; Scholl, Claudia; Fröhling, Stefan; Brors, Benedikt; Weichert, Wilko; Weitz, Jürgen; Glimm, Hanno. Succession of transiently active tumor-initiating cell clones in human pancreatic cancer xenografts. Embo Molecular Medicine. 2017;9(7):918-932. PubMed |
| Euskirchen, Philipp; Radke, Josefine; Schmidt, Marc Sören; Schulze Heuling, Eva; Kadikowski, Eric; Maricos, Meron; Knab, Felix; Grittner, Ulrike; Zerbe, Norman; Czabanka, Marcus; Dieterich, Christoph; Miletic, Hrvoje; Mørk, Sverre; Koch, Arend; Endres, Matthias; Harms, Christoph. Cellular heterogeneity contributes to subtype-specific expression of ZEB1 in human glioblastoma. Plos One. 12(9):e0185376. PubMed |
| Cortés, Marlies; Sanchez-Moral, Lidia; de Barrios, Oriol; Fernández-Aceñero, María J; Martínez-Campanario, M C; Esteve-Codina, Anna; Darling, Douglas S; Győrffy, Balázs; Lawrence, Toby; Dean, Douglas C; Postigo, Antonio. Tumor-associated macrophages (TAMs) depend on ZEB1 for their cancer-promoting roles. The Embo Journal. 2017;36(22):3336-3355. PubMed |
| Mishra, Prachi; Tang, Wei; Putluri, Vasanta; Dorsey, Tiffany H; Jin, Feng; Wang, Fang; Zhu, Donewei; Amable, Lauren; Deng, Tao; Zhang, Shaofei; Killian, J Keith; Wang, Yonghong; Minas, Tsion Z; Yfantis, Harry G; Lee, Dong H; Sreekumar, Arun; Bustin, Michael; Liu, Wei; Putluri, Nagireddy; Ambs, Stefan. ADHFE1 is a breast cancer oncogene and induces metabolic reprogramming. The Journal Of Clinical Investigation. 2018;128(1):323-340. PubMed |
| Jia, Dongya; Jolly, Mohit Kumar; Tripathi, Satyendra C; Den Hollander, Petra; Huang, Bin; Lu, Mingyang; Celiktas, Muge; Ramirez-Peña, Esmeralda; Ben-Jacob, Eshel; Onuchic, José N; Hanash, Samir M; Mani, Sendurai A; Levine, Herbert. Distinguishing mechanisms underlying EMT tristability. Cancer Convergence. 1(1):2. PubMed |
| Rosmaninho, Pedro; Mükusch, Susanne; Piscopo, Valerio; Teixeira, Vera; Raposo, Alexandre Asf; Warta, Rolf; Bennewitz, Romina; Tang, Yeman; Herold-Mende, Christel; Stifani, Stefano; Momma, Stefan; Castro, Diogo S. Zeb1 potentiates genome-wide gene transcription with Lef1 to promote glioblastoma cell invasion. The Embo Journal. 2018;37(15) PubMed |
| Roumane, Ahlima; Berthenet, Kevin; El Fassi, Chaïmaa; Ichim, Gabriel. Caspase-independent cell death does not elicit a proliferative response in melanoma cancer cells. Bmc Cell Biology. 2018;19(1):11. PubMed |
| Tekin, Cansu; Shi, Kun; Daalhuisen, Joost B; Ten Brink, Marieke S; Bijlsma, Maarten F; Spek, C Arnold. PAR1 signaling on tumor cells limits tumor growth by maintaining a mesenchymal phenotype in pancreatic cancer. Oncotarget. 2018;9(62):32010-32023. PubMed |
| Dhayat, Sameer Abdallah; Traeger, Max Michael; Rehkaemper, Jan; Stroese, Anda Jana; Steinestel, Konrad; Wardelmann, Eva; Kabar, Iyad; Senninger, Norbert. Clinical Impact of Epithelial-to-Mesenchymal Transition Regulating MicroRNAs in Pancreatic Ductal Adenocarcinoma. Cancers. 2018;10(9) PubMed |
| Ninfali, Chiara; Siles, Laura; Darling, Douglas S; Postigo, Antonio. Regulation of muscle atrophy-related genes by the opposing transcriptional activities of ZEB1/CtBP and FOXO3. Nucleic Acids Research. 2018;46(20):10697-10708. PubMed |
| Asnaghi, Laura; White, David T; Key, Nolan; Choi, Joshua; Mahale, Alka; Alkatan, Hind; Edward, Deepak P; Elkhamary, Sahar M; Al-Mesfer, Saleh; Maktabi, Azza; Hurtado, Christopher G; Lee, Grace Y; Carcaboso, Angel M; Mumm, Jeff S; Safieh, Leen Abu; Eberhart, Charles G. ACVR1C/SMAD2 signaling promotes invasion and growth in retinoblastoma. Oncogene. 2019;38(12):2056-2075. PubMed |
| Qiu, Bijun; Wei, Wei; Zhu, Jianwen; Fu, Guangshun; Lu, Dahai. EMT induced by loss of LKB1 promotes migration and invasion of liver cancer cells through ZEB1-induced YAP signaling. Oncology Letters. 2018;16(5):6465-6471. PubMed |
| Franke, Fabian Christoph; Müller, Johannes; Abal, Miguel; Medina, Eduardo Domínguez; Nitsche, Ulrich; Weidmann, Henri; Chardonnet, Solenne; Ninio, Ewa; Janssen, Klaus-Peter. The Tumor Suppressor SASH1 Interacts With the Signal Adaptor CRKL to Inhibit Epithelial-Mesenchymal Transition and Metastasis in Colorectal Cancer. Cellular And Molecular Gastroenterology And Hepatology. 7(1):33-53. PubMed |
| Harada, Hiroki; Hosoda, Kei; Moriya, Hiromitsu; Mieno, Hiroaki; Ema, Akira; Washio, Marie; Kikuchi, Mariko; Kosaka, Yoshimasa; Watanabe, Masahiko; Yamashita, Keishi. Carcinosarcoma of the esophagus: A report of 6 cases associated with zinc finger E-box-binding homeobox 1 expression. Oncology Letters. 2019;17(1):578-586. PubMed |
| Siles, Laura; Ninfali, Chiara; Cortés, Marlies; Darling, Douglas S; Postigo, Antonio. ZEB1 protects skeletal muscle from damage and is required for its regeneration. Nature Communications. 2019;10(1):1364. PubMed |
| Jolly, Mohit Kumar; Preca, Bogdan-Tiberius; Tripathi, Satyendra C; Jia, Dongya; George, Jason T; Hanash, Samir M; Brabletz, Thomas; Stemmler, Marc P; Maurer, Jochen; Levine, Herbert. Interconnected feedback loops among ESRP1, HAS2, and CD44 regulate epithelial-mesenchymal plasticity in cancer. Apl Bioengineering. 2018;2(3):031908. PubMed |
| Kim, Young-Heon; Lee, Seung Bum; Shim, Sehwan; Kim, Areumnuri; Park, Ji-Hye; Jang, Won-Suk; Lee, Sun-Joo; Myung, Jae Kyung; Park, Sunhoo; Lee, Su-Jae; Kim, Min-Jung. Hyaluronic acid synthase 2 promotes malignant phenotypes of colorectal cancer cells through transforming growth factor beta signaling. Cancer Science. 2019;110(7):2226-2236. PubMed |
| Matsumura, Yuko; Ito, Yasuhiko; Mezawa, Yoshihiro; Sulidan, Kaidiliayi; Daigo, Yataro; Hiraga, Toru; Mogushi, Kaoru; Wali, Nadila; Suzuki, Hiromu; Itoh, Takumi; Miyagi, Yohei; Yokose, Tomoyuki; Shimizu, Satoru; Takano, Atsushi; Terao, Yasuhisa; Saeki, Harumi; Ozawa, Masayuki; Abe, Masaaki; Takeda, Satoru; Okumura, Ko; Habu, Sonoko; Hino, Okio; Takeda, Kazuyoshi; Hamada, Michiaki; Orimo, Akira. Stromal fibroblasts induce metastatic tumor cell clusters via epithelial-mesenchymal plasticity. Life Science Alliance. 2019;2(4) PubMed |
| Yang, Haitang; Liang, Shun-Qing; Xu, Duo; Yang, Zhang; Marti, Thomas M; Gao, Yanyun; Kocher, Gregor J; Zhao, Heng; Schmid, Ralph A; Peng, Ren-Wang. HSP90/AXL/eIF4E-regulated unfolded protein response as an acquired vulnerability in drug-resistant KRAS-mutant lung cancer. Oncogenesis. 2019;8(9):45. PubMed |
| Asnaghi, Laura; White, David T; Yoon, Lynn; Price, Antoinette; Lee, Grace Y; Sahoo, Arpan; Mumm, Jeff S; Eberhart, Charles G. Downregulation of Nodal inhibits metastatic progression in retinoblastoma. Acta Neuropathologica Communications. 2019;7(1):137. PubMed |
| Li, Yaqi; Yao, Qianlan; Zhang, Long; Mo, Shaobo; Cai, Sanjun; Huang, Dan; Peng, Junjie. Immunohistochemistry-Based Consensus Molecular Subtypes as a Prognostic and Predictive Biomarker for Adjuvant Chemotherapy in Patients with Stage II Colorectal Cancer. The Oncologist. 2020;25(12):e1968-e1979. PubMed |
| Addison, Joseph B; Voronkova, Maria A; Fugett, James H; Lin, Chen-Chung; Linville, Nathaniel C; Trinh, Brandon; Livengood, Ryan H; Smolkin, Matthew B; Schaller, Michael D; Ruppert, J Michael; Pugacheva, Elena N; Creighton, Chad J; Ivanov, Alexey V. Functional Hierarchy and Cooperation of EMT Master Transcription Factors in Breast Cancer Metastasis. Molecular Cancer Research : Mcr. 2021;19(5):784-798. PubMed |
| Williams, Michelle M; Christenson, Jessica L; O'Neill, Kathleen I; Hafeez, Sabrina A; Ihle, Claire L; Spoelstra, Nicole S; Slansky, Jill E; Richer, Jennifer K. MicroRNA-200c restoration reveals a cytokine profile to enhance M1 macrophage polarization in breast cancer. Npj Breast Cancer. 2021;7(1):64. PubMed |
| Zhao, Qiuyan; Ren, Yingchun; Xie, Haoran; Yu, Lanting; Lu, Jiawei; Jiang, Weiliang; Xiao, Wenqin; Zhu, Zhonglin; Wan, Rong; Li, Baiwen. ELK3 Mediated by ZEB1 Facilitates the Growth and Metastasis of Pancreatic Carcinoma by Activating the Wnt/β-Catenin Pathway. Frontiers In Cell And Developmental Biology. 9( 34409034):700192. PubMed |
| Koch, Katharina; Hartmann, Rudolf; Suwala, Abigail Kora; Rios, Dayana Herrera; Kamp, Marcel Alexander; Sabel, Michael; Steiger, Hans-Jakob; Willbold, Dieter; Sharma, Amit; Kahlert, Ulf Dietrich; Maciaczyk, Jarek. Overexpression of Cystine/Glutamate Antiporter xCT Correlates with Nutrient Flexibility and ZEB1 Expression in Highly Clonogenic Glioblastoma Stem-like Cells (GSCs). Cancers. 2021;13(23) PubMed |
| Ye, Qing; Falatovich, Brianne; Singh, Salvi; Ivanov, Alexey V; Eubank, Timothy D; Guo, Nancy Lan. A Multi-Omics Network of a Seven-Gene Prognostic Signature for Non-Small Cell Lung Cancer. International Journal Of Molecular Sciences. 2021;23(1) PubMed |
| Rodriguez, Ernesto; Boelaars, Kelly; Brown, Kari; Madunić, Katarina; van Ee, Thomas; Dijk, Frederike; Verheij, Joanne; Li, R J Eveline; Schetters, Sjoerd T T; Meijer, Laura L; Le Large, Tessa Y S; Driehuis, Else; Clevers, Hans; Bruijns, Sven C M; O'Toole, Tom; van Vliet, Sandra J; Bijlsma, Maarten F; Wuhrer, Manfred; Kazemier, Geert; Giovannetti, Elisa; Garcia-Vallejo, Juan J; van Kooyk, Yvette. Analysis of the glyco-code in pancreatic ductal adenocarcinoma identifies glycan-mediated immune regulatory circuits. Communications Biology. 2022;5(1):41. PubMed |
| Jia, Baoqing; Liu, Hongyi; Kong, Qinglong; Li, Bing. Overexpression of ZEB1 associated with metastasis and invasion in patients with gastric carcinoma. Molecular And Cellular Biochemistry. 2012;366(1-2):223-9. PubMed |
| Hanna, Jason A; Wimberly, Hallie; Kumar, Salil; Slack, Frank; Agarwal, Seema; Rimm, David L. Quantitative analysis of microRNAs in tissue microarrays by in situ hybridization. Biotechniques. 2012;52(4):235-45. PubMed |
| De Sousa E Melo, Felipe; Wang, Xin; Jansen, Marnix; Fessler, Evelyn; Trinh, Anne; de Rooij, Laura P M H; de Jong, Joan H; de Boer, Onno J; van Leersum, Ronald; Bijlsma, Maarten F; Rodermond, Hans; van der Heijden, Maartje; van Noesel, Carel J M; Tuynman, Jurriaan B; Dekker, Evelien; Markowetz, Florian; Medema, Jan Paul; Vermeulen, Louis. Poor-prognosis colon cancer is defined by a molecularly distinct subtype and develops from serrated precursor lesions. Nature Medicine. 2013;19(5):614-8. PubMed |
| Vannier, Corinne; Mock, Kerstin; Brabletz, Thomas; Driever, Wolfgang. Zeb1 regulates E-cadherin and Epcam (epithelial cell adhesion molecule) expression to control cell behavior in early zebrafish development. The Journal Of Biological Chemistry. 2013;288(26):18643-59. PubMed |
| Pacurari, Maricica; Addison, Joseph B; Bondalapati, Naveen; Wan, Ying-Wooi; Luo, Dajie; Qian, Yong; Castranova, Vincent; Ivanov, Alexey V; Guo, Nancy Lan. The microRNA-200 family targets multiple non-small cell lung cancer prognostic markers in H1299 cells and BEAS-2B cells. International Journal Of Oncology. 2013;43(2):548-60. PubMed |
| Konoeda, C; Koinuma, D; Morishita, Y; Sano, A; Nagayama, K; Motomura, N; Kakimi, K; Miyazono, K; Nakajima, J; Nicolls, M R; Murakawa, T. Epithelial to mesenchymal transition in murine tracheal allotransplantation: an immunohistochemical observation. Transplantation Proceedings. 2013;45(5):1797-801. PubMed |
| Werner, Stefan; Frey, Sabrina; Riethdorf, Sabine; Schulze, Christian; Alawi, Malik; Kling, Lea; Vafaizadeh, Vida; Sauter, Guido; Terracciano, Luigi; Schumacher, Udo; Pantel, Klaus; Assmann, Volker. Dual roles of the transcription factor grainyhead-like 2 (GRHL2) in breast cancer. The Journal Of Biological Chemistry. 2013;288(32):22993-3008. PubMed |
| Jakobsen, Kristine Raaby; Sørensen, Emilie; Brøndum, Karin Kathrine; Daugaard, Tina Fuglsang; Thomsen, Rune; Nielsen, Anders Lade. Direct RNA sequencing mediated identification of mRNA localized in protrusions of human MDA-MB-231 metastatic breast cancer cells. Journal Of Molecular Signaling. 2013;8(1):9. PubMed |
| Pieraccioli, Marco; Imbastari, Francesca; Antonov, Alexey; Melino, Gerry; Raschellà, Giuseppe. Activation of miR200 by c-Myb depends on ZEB1 expression and miR200 promoter methylation. Cell Cycle (Georgetown, Tex.). 2013;12(14):2309-20. PubMed |
| Roca, Hernan; Hernandez, James; Weidner, Savannah; McEachin, Richard C; Fuller, David; Sud, Sudha; Schumann, Taibriana; Wilkinson, John E; Zaslavsky, Alexander; Li, Hangwen; Maher, Christopher A; Daignault-Newton, Stephanie; Healy, Patrick N; Pienta, Kenneth J. Transcription factors OVOL1 and OVOL2 induce the mesenchymal to epithelial transition in human cancer. Plos One. 8(10):e76773. PubMed |
| Zeindl-Eberhart, Evelyn; Brandl, Lydia; Liebmann, Sibylle; Ormanns, Steffen; Scheel, Silvio K; Brabletz, Thomas; Kirchner, Thomas; Jung, Andreas. Epithelial-mesenchymal transition induces endoplasmic-reticulum-stress response in human colorectal tumor cells. Plos One. 9(1):e87386. PubMed |
| Ceppi, Paolo; Hadji, Abbas; Kohlhapp, Frederick J; Pattanayak, Abhinandan; Hau, Annika; Liu, Xia; Liu, Huiping; Murmann, Andrea E; Peter, Marcus E. CD95 and CD95L promote and protect cancer stem cells. Nature Communications. 2014;5( 25366259):5238. PubMed |
| Davidson, Ben; Holth, Arild; Hellesylt, Ellen; Tan, Tuan Zea; Huang, Ruby Yun-Ju; Tropé, Claes; Nesland, Jahn M; Thiery, Jean Paul. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Human Pathology. 2015;46(1):1-8. PubMed |
| Kim, Rae-Kwon; Cui, Yan-Hong; Yoo, Ki-Chun; Kim, In-Gyu; Lee, Minyoung; Choi, Yung Hyun; Suh, Yongjoon; Lee, Su-Jae. Radiation promotes malignant phenotypes through SRC in breast cancer cells. Cancer Science. 2015;106(1):78-85. PubMed |
| Meidhof, Simone; Brabletz, Simone; Lehmann, Waltraut; Preca, Bogdan-Tiberius; Mock, Kerstin; Ruh, Manuel; Schüler, Julia; Berthold, Maria; Weber, Anika; Burk, Ulrike; Lübbert, Michael; Puhr, Martin; Culig, Zoran; Wellner, Ulrich; Keck, Tobias; Bronsert, Peter; Küsters, Simon; Hopt, Ulrich T; Stemmler, Marc P; Brabletz, Thomas. ZEB1-associated drug resistance in cancer cells is reversed by the class I HDAC inhibitor mocetinostat. Embo Molecular Medicine. 2015;7(6):831-47. PubMed |
| Sundararajan, Vignesh; Gengenbacher, Nicolas; Stemmler, Marc P; Kleemann, Julia A; Brabletz, Thomas; Brabletz, Simone. The ZEB1/miR-200c feedback loop regulates invasion via actin interacting proteins MYLK and TKS5. Oncotarget. 2015;6(29):27083-96. PubMed |
| Li, Xiufang; Huang, Ruixia; Li, Ruth Holm; Trope, Claes G; Nesland, Jahn M; Suo, Zhenhe. Expression of zinc finger E-box-binding homeobox factor 1 in epithelial ovarian cancer: A clinicopathological analysis of 238 patients. Molecular And Clinical Oncology. 2016;4(1):18-22. PubMed |
| Lehmann, Waltraut; Mossmann, Dirk; Kleemann, Julia; Mock, Kerstin; Meisinger, Chris; Brummer, Tilman; Herr, Ricarda; Brabletz, Simone; Stemmler, Marc P; Brabletz, Thomas. ZEB1 turns into a transcriptional activator by interacting with YAP1 in aggressive cancer types. Nature Communications. 2016;7( 26876920):10498. PubMed |
| Fessler, Evelyn; Drost, Jarno; van Hooff, Sander R; Linnekamp, Janneke F; Wang, Xin; Jansen, Marnix; De Sousa E Melo, Felipe; Prasetyanti, Pramudita R; IJspeert, Joep Eg; Franitza, Marek; Nürnberg, Peter; van Noesel, Carel Jm; Dekker, Evelien; Vermeulen, Louis; Clevers, Hans; Medema, Jan Paul. TGFβ signaling directs serrated adenomas to the mesenchymal colorectal cancer subtype. Embo Molecular Medicine. 2016;8(7):745-60. PubMed |
| Galardi, Silvia; Savino, Mauro; Scagnoli, Fiorella; Pellegatta, Serena; Pisati, Federica; Zambelli, Federico; Illi, Barbara; Annibali, Daniela; Beji, Sara; Orecchini, Elisa; Alberelli, Maria Adele; Apicella, Clara; Fontanella, Rosaria Anna; Michienzi, Alessandro; Finocchiaro, Gaetano; Farace, Maria Giulia; Pavesi, Giulio; Ciafrè, Silvia Anna; Nasi, Sergio. Resetting cancer stem cell regulatory nodes upon MYC inhibition. Embo Reports. 2016;17(12):1872-1889. PubMed |
| Preca, Bogdan-Tiberius; Bajdak, Karolina; Mock, Kerstin; Lehmann, Waltraut; Sundararajan, Vignesh; Bronsert, Peter; Matzge-Ogi, Alexandra; Orian-Rousseau, Véronique; Brabletz, Simone; Brabletz, Thomas; Maurer, Jochen; Stemmler, Marc P. A novel ZEB1/HAS2 positive feedback loop promotes EMT in breast cancer. Oncotarget. 2017;8(7):11530-11543. PubMed |
| Larsson, Chatarina; Ali, Muhammad Akhtar; Pandzic, Tatjana; Lindroth, Anders M; He, Liqun; Sjöblom, Tobias. Loss of DIP2C in RKO cells stimulates changes in DNA methylation and epithelial-mesenchymal transition. Bmc Cancer. 2017;17(1):487. PubMed |
| Kang, Hye-Min; Son, Han-Sun; Cui, Yan-Hong; Youn, BuHyun; Son, Beomseok; Kaushik, Nagendra Kumar; Uddin, Nizam; Lee, Jae-Seong; Song, Jie-Young; Kaushik, Neha; Lee, Su-Jae. Phytosphingosine exhibits an anti-epithelial-mesenchymal transition function by the inhibition of EGFR signaling in human breast cancer cells. Oncotarget. 2017;8(44):77794-77808. PubMed |
| Yamashita, Masahiro; Ogasawara, Masahito; Kawasaki, Yasushi; Niisato, Miyuki; Saito, Heisuke; Kasai, Shuya; Maesawa, Chihaya; Maemondo, Makoto; Yamauchi, Kohei. Deficiency of protein-L-isoaspartate (D-aspartate) O-methyl-transferase expression under endoplasmic reticulum stress promotes epithelial mesenchymal transition in lung adenocarcinoma. Oncotarget. 2018;9(17):13287-13300. PubMed |
| Hong, Deli; Fritz, Andrew J; Finstad, Kristiaan H; Fitzgerald, Mark P; Weinheimer, Adam; Viens, Adam L; Ramsey, Jon; Stein, Janet L; Lian, Jane B; Stein, Gary S. Suppression of Breast Cancer Stem Cells and Tumor Growth by the RUNX1 Transcription Factor. Molecular Cancer Research : Mcr. 2018;16(12):1952-1964. PubMed |
| Rogers, Thomas J; Christenson, Jessica L; Greene, Lisa I; O'Neill, Kathleen I; Williams, Michelle M; Gordon, Michael A; Nemkov, Travis; D'Alessandro, Angelo; Degala, Greg D; Shin, Jimin; Tan, Aik-Choon; Cittelly, Diana M; Lambert, James R; Richer, Jennifer K. Reversal of Triple-Negative Breast Cancer EMT by miR-200c Decreases Tryptophan Catabolism and a Program of Immunosuppression. Molecular Cancer Research : Mcr. 2019;17(1):30-41. PubMed |
| Hoang-Minh, Lan B; Siebzehnrubl, Florian A; Yang, Changlin; Suzuki-Hatano, Silveli; Dajac, Kyle; Loche, Tyler; Andrews, Nicholas; Schmoll Massari, Michael; Patel, Jaimin; Amin, Krisha; Vuong, Alvin; Jimenez-Pascual, Ana; Kubilis, Paul; Garrett, Timothy J; Moneypenny, Craig; Pacak, Christina A; Huang, Jianping; Sayour, Elias J; Mitchell, Duane A; Sarkisian, Matthew R; Reynolds, Brent A; Deleyrolle, Loic P. Infiltrative and drug-resistant slow-cycling cells support metabolic heterogeneity in glioblastoma. The Embo Journal. 2018;37(23) PubMed |
| Zhang, Qing; Wang, Chen; Cliby, William A. Cancer-associated stroma significantly contributes to the mesenchymal subtype signature of serous ovarian cancer. Gynecologic Oncology. 2019;152(2):368-374. PubMed |
| Hirano, Daiki; Urabe, Yuji; Tanaka, Shinji; Nakamura, Koki; Ninomiya, Yuki; Yuge, Ryo; Hayashi, Ryohei; Oka, Shiro; Kitadai, Yasuhiko; Shimamoto, Fumio; Arihiro, Koji; Chayama, Kazuaki. Early-stage serrated adenocarcinomas are divided into several molecularly distinct subtypes. Plos One. 14(2):e0211477. PubMed |
| Filipović, Jelena; Bosić, Martina; Ćirović, Sanja; Životić, Maja; Dunđerović, Duško; Đorđević, Dejan; Živković-Perišić, Snežana; Lipkovski, Aleksandar; Marković-Lipkovski, Jasmina. PRMT1 expression in renal cell tumors- application in differential diagnosis and prognostic relevance. Diagnostic Pathology. 2019;14(1):120. PubMed |
| Yoshimoto, Shohei; Tanaka, Fumie; Morita, Hiromitsu; Hiraki, Akimitsu; Hashimoto, Shuichi. Hypoxia-induced HIF-1α and ZEB1 are critical for the malignant transformation of ameloblastoma via TGF-β-dependent EMT. Cancer Medicine. 2019;8(18):7822-7832. PubMed |
| de la Cuesta, Fernando; Passalacqua, Ilaria; Rodor, Julie; Bhushan, Raghu; Denby, Laura; Baker, Andrew H. Extracellular vesicle cross-talk between pulmonary artery smooth muscle cells and endothelium during excessive TGF-β signalling: implications for PAH vascular remodelling. Cell Communication And Signaling : Ccs. 2019;17(1):143. PubMed |
| Tian, Chenxi; Öhlund, Daniel; Rickelt, Steffen; Lidström, Tommy; Huang, Ying; Hao, Liangliang; Zhao, Renee T; Franklin, Oskar; Bhatia, Sangeeta N; Tuveson, David A; Hynes, Richard O. Cancer Cell-Derived Matrisome Proteins Promote Metastasis in Pancreatic Ductal Adenocarcinoma. Cancer Research. 2020;80(7):1461-1474. PubMed |
| Murata, Maho; Ito, Takamichi; Tanaka, Yuka; Yamamura, Kazuhiko; Furue, Kazuhisa; Furue, Masutaka. OVOL2-Mediated ZEB1 Downregulation May Prevent Promotion of Actinic Keratosis to Cutaneous Squamous Cell Carcinoma. Journal Of Clinical Medicine. 2020;9(3) PubMed |
| Steins, Anne; van Mackelenbergh, Madelaine G; van der Zalm, Amber P; Klaassen, Remy; Serrels, Bryan; Goris, Sandrine G; Kocher, Hemant M; Waasdorp, Cynthia; de Jong, Joan H; Tekin, Cansu; Besselink, Marc G; Busch, Olivier R; van de Vijver, Marc J; Verheij, Joanne; Dijk, Frederike; van Tienhoven, Geertjan; Wilmink, Johanna W; Medema, Jan Paul; van Laarhoven, Hanneke Wm; Bijlsma, Maarten F. High-grade mesenchymal pancreatic ductal adenocarcinoma drives stromal deactivation through CSF-1. Embo Reports. 2020;21(5):e48780. PubMed |
| Fritz, Andrew J; Hong, Deli; Boyd, Joseph; Kost, Jason; Finstaad, Kristiaan H; Fitzgerald, Mark P; Hanna, Sebastian; Abuarqoub, Alqassem H; Malik, Miles; Bushweller, John; Tye, Coralee; Ghule, Prachi; Gordon, Jonathan; Frietze, Seth; Zaidi, Sayyed K; Lian, Jane B; Stein, Janet L; Stein, Gary S. RUNX1 and RUNX2 transcription factors function in opposing roles to regulate breast cancer stem cells. Journal Of Cellular Physiology. 2020;235(10):7261-7272. PubMed |
| Koch, Katharina; Hartmann, Rudolf; Tsiampali, Julia; Uhlmann, Constanze; Nickel, Ann-Christin; He, Xiaoling; Kamp, Marcel A; Sabel, Michael; Barker, Roger A; Steiger, Hans-Jakob; Hänggi, Daniel; Willbold, Dieter; Maciaczyk, Jaroslaw; Kahlert, Ulf D. A comparative pharmaco-metabolomic study of glutaminase inhibitors in glioma stem-like cells confirms biological effectiveness but reveals differences in target-specificity. Cell Death Discovery. 6( 32337072):20. PubMed |
| Recouvreux, Maria Victoria; Moldenhauer, Matthew R; Galenkamp, Koen M O; Jung, Michael; James, Brian; Zhang, Yijuan; Lowy, Andrew; Bagchi, Anindya; Commisso, Cosimo. Glutamine depletion regulates Slug to promote EMT and metastasis in pancreatic cancer. The Journal Of Experimental Medicine. 2020;217(9) PubMed |
| Flammang, Isabelle; Reese, Moritz; Yang, Zixuan; Eble, Johannes A; Dhayat, Sameer A. Tumor-Suppressive miR-192-5p Has Prognostic Value in Pancreatic Ductal Adenocarcinoma. Cancers. 2020;12(6) PubMed |
| Kojima, Masataka; Kajino, Kazunori; Momose, Shuji; Wali, Nadila; Hlaing, May Thinzar; Han, Bo; Yue, Liang; Abe, Masaaki; Fujii, Tomoaki; Ikeda, Katsuhisa; Hino, Okio. Possible reversibility between epithelioid and sarcomatoid types of mesothelioma is independent of ERC/mesothelin expression. Respiratory Research. 2020;21(1):187. PubMed |
| Feldker, Nora; Ferrazzi, Fulvia; Schuhwerk, Harald; Widholz, Sebastian A; Guenther, Kerstin; Frisch, Isabell; Jakob, Kathrin; Kleemann, Julia; Riegel, Dania; Bönisch, Ulrike; Lukassen, Sören; Eccles, Rebecca L; Schmidl, Christian; Stemmler, Marc P; Brabletz, Thomas; Brabletz, Simone. Genome-wide cooperation of EMT transcription factor ZEB1 with YAP and AP-1 in breast cancer. The Embo Journal. 2020;39(17):e103209. PubMed |
| D'Alterio, Crescenzo; Zannetti, Antonella; Trotta, Anna Maria; Ieranò, Caterina; Napolitano, Maria; Rea, Giuseppina; Greco, Adelaide; Maiolino, Piera; Albanese, Sandra; Scognamiglio, Giosuè; Tatangelo, Fabiana; Tafuto, Salvatore; Portella, Luigi; Santagata, Sara; Nasti, Guglielmo; Ottaiano, Alessandro; Pacelli, Roberto; Delrio, Paolo; Botti, Gerardo; Scala, Stefania. New CXCR4 Antagonist Peptide R (Pep R) Improves Standard Therapy in Colorectal Cancer. Cancers. 2020;12(7) PubMed |
| Tsubochi, Hiroyoshi; Minegishi, Kentaro; Goto, Akiteru; Nakamura, Ritsuko; Matsubara, Daisuke; Dobashi, Yoh. EphA2, a possible target of miR-200a, functions through the AKT2 pathway in human lung carcinoma. International Journal Of Clinical And Experimental Pathology. 13(8):2201-2210. PubMed |
| Liu, Dajia; Steins, Anne; Klaassen, Remy; van der Zalm, Amber P; Bennink, Roel J; van Tienhoven, Geertjan; Besselink, Marc G; Bijlsma, Maarten F; van Laarhoven, Hanneke W M. Soluble Compounds Released by Hypoxic Stroma Confer Invasive Properties to Pancreatic Ductal Adenocarcinoma. Biomedicines. 2020;8(11) PubMed |
| Tsiampali, Julia; Neumann, Silke; Giesen, Beatriz; Koch, Katharina; Maciaczyk, Donata; Janiak, Christoph; Hänggi, Daniel; Maciaczyk, Jaroslaw. Enzymatic Activity of CD73 Modulates Invasion of Gliomas via Epithelial-Mesenchymal Transition-Like Reprogramming. Pharmaceuticals (Basel, Switzerland). 2020;13(11) PubMed |
| Anastasov, Nataša; Hirmer, Elisabeth; Klenner, Marbod; Ott, Jessica; Falkenberg, Natalie; Bao, Xuanwen; Mutschelknaus, Lisa; Moertl, Simone; Combs, Stephanie; Atkinson, Michael J; Schmid, Thomas. MEK1 Inhibitor Combined with Irradiation Reduces Migration of Breast Cancer Cells Including miR-221 and ZEB1 EMT Marker Expression. Cancers. 2020;12(12) PubMed |
| Sadłecki, Paweł; Jóźwicki, Jakub; Antosik, Paulina; Walentowicz-Sadłecka, Małgorzata. Expression of Selected Epithelial-Mesenchymal Transition Transcription Factors in Endometrial Cancer. Biomed Research International. 2020( 33457409):4584250. PubMed |
| Ye, Qing; Mohamed, Rehab; Dakhlallah, Duaa; Gencheva, Marieta; Hu, Gangqing; Pearce, Martin C; Kolluri, Siva Kumar; Marsh, Clay B; Eubank, Timothy D; Ivanov, Alexey V; Guo, Nancy Lan. Molecular Analysis of ZNF71 KRAB in Non-Small-Cell Lung Cancer. International Journal Of Molecular Sciences. 2021;22(7) PubMed |
| Kumar-Singh, Ashish; Parniewska, Malgorzata Maria; Giotopoulou, Nikolina; Javadi, Joman; Sun, Wenwen; Szatmári, Tünde; Dobra, Katalin; Hjerpe, Anders; Fuxe, Jonas. Nuclear Syndecan-1 Regulates Epithelial-Mesenchymal Plasticity in Tumor Cells. Biology. 2021;10(6) PubMed |
| Tang, Yu Hin; Rockstroh, Anja; Sokolowski, Kamil A; Lynam, Layla-Rose; Lehman, Melanie; Thompson, Erik W; Gregory, Philip A; Nelson, Colleen C; Volpert, Marianna; Hollier, Brett G. Neuropilin-1 is over-expressed in claudin-low breast cancer and promotes tumor progression through acquisition of stem cell characteristics and RAS/MAPK pathway activation. Breast Cancer Research : Bcr. 2022;24(1):8. PubMed |
| Azcue, Pablo; Encío, Ignacio; Guerrero Setas, David; Suarez Alecha, Javier; Galbete, Arkaitz; Mercado, María; Vera, Ruth; Gomez-Dorronsoro, Maria Luisa. PD-L1 as a Prognostic Factor in Early-Stage Colon Carcinoma within the Immunohistochemical Molecular Subtype Classification. Cancers. 2021;13(8) PubMed |
| Sacchetti, Andrea; Teeuwssen, Miriam; Verhagen, Mathijs; Joosten, Rosalie; Xu, Tong; Stabile, Roberto; van der Steen, Berdine; Watson, Martin M; Gusinac, Alem; Kim, Won Kyu; Ubink, Inge; Van de Werken, Harmen Jg; Fumagalli, Arianna; Paauwe, Madelon; Van Rheenen, Jacco; Sansom, Owen J; Kranenburg, Onno; Fodde, Riccardo. Phenotypic plasticity underlies local invasion and distant metastasis in colon cancer. Elife. 2021;10( 34036938) PubMed |
| Kang, JiHoon; Park, Ji-Hye; Kong, Jun Suk; Kim, Min Jung; Lee, Seung-Sook; Park, Sunhoo; Myung, Jae Kyung. PINX1 promotes malignant transformation of thyroid cancer through the activation of the AKT/MAPK/β-catenin signaling pathway. American Journal Of Cancer Research. 11(11):5485-5495. PubMed |
| Strating, Esther; Wassenaar, Emma; Verhagen, Mathijs; Rauwerdink, Paulien; van Schelven, Susanne; de Hingh, Ignace; Rinkes, Inne Borel; Boerma, Djamila; Witkamp, Arjen; Lacle, Miangela; Fodde, Riccardo; Volckmann, Richard; Koster, Jan; Stedingk, Kris; Giesel, Frederik; de Roos, Remmert; Poot, Alex; Bol, Guus; Lam, Marnix; Elias, Sjoerd; Kranenburg, Onno. Fibroblast activation protein identifies Consensus Molecular Subtype 4 in colorectal cancer and allows its detection by (68)Ga-FAPI-PET imaging. British Journal Of Cancer. 2022;127(1):145-155. PubMed |
| Napoli, Francesca; Rapa, Ida; Izzo, Stefania; Rigutto, Angelica; Libener, Roberta; Riganti, Chiara; Bironzo, Paolo; Taulli, Riccardo; Papotti, Mauro; Volante, Marco; Scagliotti, Giorgio; Righi, Luisella. Micro-RNA-215 and -375 regulate thymidylate synthase protein expression in pleural mesothelioma and mediate epithelial to mesenchymal transition. Virchows Archiv : An International Journal Of Pathology. 2022;481(2):233-244. PubMed |
| Kim, Ji Yoon; Han, Seung Yoon; Yoo, Jung; Kim, Go Woon; Jeon, Yu Hyun; Lee, Sang Wu; Park, Jongsun; Kwon, So Hee. HDAC8-Selective Inhibition by PCI-34051 Enhances the Anticancer Effects of ACY-241 in Ovarian Cancer Cells. International Journal Of Molecular Sciences. 2022;23(15) PubMed |
| Freckmann, Eva C; Sandilands, Emma; Cumming, Erin; Neilson, Matthew; Román-Fernández, Alvaro; Nikolatou, Konstantina; Nacke, Marisa; Lannagan, Tamsin R M; Hedley, Ann; Strachan, David; Salji, Mark; Morton, Jennifer P; McGarry, Lynn; Leung, Hing Y; Sansom, Owen J; Miller, Crispin J; Bryant, David M. Traject3d allows label-free identification of distinct co-occurring phenotypes within 3D culture by live imaging. Nature Communications. 2022;13(1):5317. PubMed |
| Pedrosa, Leire; Foguet, Carles; Oliveres, Helena; Archilla, Iván; de Herreros, Marta García; Rodríguez, Adela; Postigo, Antonio; Benítez-Ribas, Daniel; Camps, Jordi; Cuatrecasas, Miriam; Castells, Antoni; Prat, Aleix; Thomson, Timothy M; Maurel, Joan; Cascante, Marta. A novel gene signature unveils three distinct immune-metabolic rewiring patterns conserved across diverse tumor types and associated with outcomes. Frontiers In Immunology. 13( 36119118):926304. PubMed |
| Mochizuki, Kenichi; Kudo, Shin-Ei; Kato, Kazuki; Kudo, Koki; Ogawa, Yushi; Kouyama, Yuta; Takashina, Yuki; Ichimasa, Katsuro; Tobo, Taro; Toshima, Takeo; Hisamatsu, Yuichi; Yonemura, Yusuke; Masuda, Takaaki; Miyachi, Hideyuki; Ishida, Fumio; Nemoto, Tetsuo; Mimori, Koshi. Molecular and clinicopathological differences between depressed and protruded T2 colorectal cancer. Plos One. 17(10):e0273566. PubMed |
| Place, Elsie; Manning, Elizabeth; Kim, Dong Won; Kinjo, Arisa; Nakamura, Go; Ohyama, Kyoji. SHH and Notch regulate SOX9+ progenitors to govern arcuate POMC neurogenesis. Frontiers In Neuroscience. 16( 36033614):855288. PubMed |
| Jarrosson, Loraine; Dalle, Stéphane; Costechareyre, Clélia; Tang, Yaqi; Grimont, Maxime; Plaschka, Maud; Lacourrège, Marjorie; Teinturier, Romain; Le Bouar, Myrtille; Maucort-Boulch, Delphine; Eberhardt, Anaïs; Castellani, Valérie; Caramel, Julie; Delloye-Bourgeois, Céline. An in vivo avian model of human melanoma to perform rapid and robust preclinical studies. Embo Molecular Medicine. 2023;15(3):e16629. PubMed |