Anti ZBTB7A pAb (ATL-HPA046387)

Atlas Antibodies

Catalog No.:
ATL-HPA046387-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 7A
Gene Name: ZBTB7A
Alternative Gene Name: DKFZp547O146, FBI-1, LRF, pokemon, ZBTB7, ZNF857A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035011: 76%, ENSRNOG00000020161: 74%
Entrez Gene ID: 51341
Uniprot ID: O95365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN
Gene Sequence AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN
Gene ID - Mouse ENSMUSG00000035011
Gene ID - Rat ENSRNOG00000020161
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBTB7A pAb (ATL-HPA046387)
Datasheet Anti ZBTB7A pAb (ATL-HPA046387) Datasheet (External Link)
Vendor Page Anti ZBTB7A pAb (ATL-HPA046387) at Atlas Antibodies

Documents & Links for Anti ZBTB7A pAb (ATL-HPA046387)
Datasheet Anti ZBTB7A pAb (ATL-HPA046387) Datasheet (External Link)
Vendor Page Anti ZBTB7A pAb (ATL-HPA046387)