Anti ZBTB7A pAb (ATL-HPA046387)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046387-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ZBTB7A
Alternative Gene Name: DKFZp547O146, FBI-1, LRF, pokemon, ZBTB7, ZNF857A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035011: 76%, ENSRNOG00000020161: 74%
Entrez Gene ID: 51341
Uniprot ID: O95365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN |
| Gene Sequence | AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN |
| Gene ID - Mouse | ENSMUSG00000035011 |
| Gene ID - Rat | ENSRNOG00000020161 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZBTB7A pAb (ATL-HPA046387) | |
| Datasheet | Anti ZBTB7A pAb (ATL-HPA046387) Datasheet (External Link) |
| Vendor Page | Anti ZBTB7A pAb (ATL-HPA046387) at Atlas Antibodies |
| Documents & Links for Anti ZBTB7A pAb (ATL-HPA046387) | |
| Datasheet | Anti ZBTB7A pAb (ATL-HPA046387) Datasheet (External Link) |
| Vendor Page | Anti ZBTB7A pAb (ATL-HPA046387) |