Anti ZBTB5 pAb (ATL-HPA021521)

Atlas Antibodies

Catalog No.: ATL-HPA021521-25

Protein Description: zinc finger and BTB domain containing 5
Gene Name: ZBTB5
Alternative Gene Name: KIAA0354
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049657: 94%, ENSRNOG00000012726: 93%
Entrez Gene ID: 9925
Uniprot ID: O15062
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNN
• Gene Sequence: GEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNN
• Gene ID - Mouse: ENSMUSG00000049657
• Gene ID - Rat: ENSRNOG00000012726
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZBTB5 pAb (ATL-HPA021521) – 1 Found

Coffin, Stephanie L; Durham, Mark A; Nitschke, Larissa; Xhako, Eder; Brown, Amanda M; Revelli, Jean-Pierre; Villavicencio Gonzalez, Esmeralda; Lin, Tao; Handler, Hillary P; Dai, Yanwan; Trostle, Alexander J; Wan, Ying-Wooi; Liu, Zhandong; Sillitoe, Roy V; Orr, Harry T; Zoghbi, Huda Y. Disruption of the ATXN1-CIC complex reveals the role of additional nuclear ATXN1 interactors in spinocerebellar ataxia type 1. Neuron. 2023;111(4):481-492.e8.