Anti ZBTB21 pAb (ATL-HPA031758)

Atlas Antibodies

Catalog No.:
ATL-HPA031758-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 21
Gene Name: ZBTB21
Alternative Gene Name: KIAA1227, ZNF295
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046962: 83%, ENSRNOG00000001623: 45%
Entrez Gene ID: 49854
Uniprot ID: Q9ULJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPLGVNKVAKPKEHAPLASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKCEYKKLTC
Gene Sequence KPLGVNKVAKPKEHAPLASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKCEYKKLTC
Gene ID - Mouse ENSMUSG00000046962
Gene ID - Rat ENSRNOG00000001623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBTB21 pAb (ATL-HPA031758)
Datasheet Anti ZBTB21 pAb (ATL-HPA031758) Datasheet (External Link)
Vendor Page Anti ZBTB21 pAb (ATL-HPA031758) at Atlas Antibodies

Documents & Links for Anti ZBTB21 pAb (ATL-HPA031758)
Datasheet Anti ZBTB21 pAb (ATL-HPA031758) Datasheet (External Link)
Vendor Page Anti ZBTB21 pAb (ATL-HPA031758)