Anti ZBTB20 pAb (ATL-HPA016815)

Atlas Antibodies

Catalog No.: ATL-HPA016815-25

Protein Description: zinc finger and BTB domain containing 20
Gene Name: ZBTB20
Alternative Gene Name: DKFZp566F123, DPZF, ODA-8S, ZNF288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022708: 91%, ENSRNOG00000056716: 90%
Entrez Gene ID: 26137
Uniprot ID: Q9HC78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQ
• Gene Sequence: SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQ
• Gene ID - Mouse: ENSMUSG00000022708
• Gene ID - Rat: ENSRNOG00000056716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZBTB20 pAb (ATL-HPA016815) – 5 Found

Tonchev, Anton B; Tuoc, Tran Cong; Rosenthal, Eva H; Studer, Michèle; Stoykova, Anastassia. Zbtb20 modulates the sequential generation of neuronal layers in developing cortex. Molecular Brain. 2016;9(1):65. 

Wu, Quan; Shichino, Yuichi; Abe, Takaya; Suetsugu, Taeko; Omori, Ayaka; Kiyonari, Hiroshi; Iwasaki, Shintaro; Matsuzaki, Fumio. Selective translation of epigenetic modifiers affects the temporal pattern and differentiation of neural stem cells. Nature Communications. 2022;13(1):470. 

Kojima, Kentaro; Takata, Akemi; Vadnais, Charles; Otsuka, Motoyuki; Yoshikawa, Takeshi; Akanuma, Masao; Kondo, Yuji; Kang, Young Jun; Kishikawa, Takahiro; Kato, Naoya; Xie, Zhifang; Zhang, Weiping J; Yoshida, Haruhiko; Omata, Masao; Nepveu, Alain; Koike, Kazuhiko. MicroRNA122 is a key regulator of α-fetoprotein expression and influences the aggressiveness of hepatocellular carcinoma. Nature Communications. 2011;2( 21654638):338. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Nagao, Motoshi; Ogata, Toru; Sawada, Yasuhiro; Gotoh, Yukiko. Zbtb20 promotes astrocytogenesis during neocortical development. Nature Communications. 2016;7( 27000654):11102.