Anti ZBTB16 pAb (ATL-HPA001499)

Atlas Antibodies

Catalog No.:
ATL-HPA001499-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 16
Gene Name: ZBTB16
Alternative Gene Name: PLZF, ZNF145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066687: 98%, ENSRNOG00000029980: 97%
Entrez Gene ID: 7704
Uniprot ID: Q05516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
Gene Sequence HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
Gene ID - Mouse ENSMUSG00000066687
Gene ID - Rat ENSRNOG00000029980
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBTB16 pAb (ATL-HPA001499)
Datasheet Anti ZBTB16 pAb (ATL-HPA001499) Datasheet (External Link)
Vendor Page Anti ZBTB16 pAb (ATL-HPA001499) at Atlas Antibodies

Documents & Links for Anti ZBTB16 pAb (ATL-HPA001499)
Datasheet Anti ZBTB16 pAb (ATL-HPA001499) Datasheet (External Link)
Vendor Page Anti ZBTB16 pAb (ATL-HPA001499)
Citations for Anti ZBTB16 pAb (ATL-HPA001499) – 7 Found
Gassei, Kathrin; Sheng, Yi; Fayomi, Adetunji; Mital, Payal; Sukhwani, Meena; Lin, Chih-Cheng; Peters, Karen A; Althouse, Andrew; Valli, Hanna; Orwig, Kyle E. DDX4-EGFP transgenic rat model for the study of germline development and spermatogenesis. Biology Of Reproduction. 2017;96(3):707-719.  PubMed
Del Vento, Federico; Poels, Jonathan; Vermeulen, Maxime; Ucakar, Bernard; Giudice, Maria Grazia; Kanbar, Marc; des Rieux, Anne; Wyns, Christine. Accelerated and Improved Vascular Maturity after Transplantation of Testicular Tissue in Hydrogels Supplemented with VEGF- and PDGF-Loaded Nanoparticles. International Journal Of Molecular Sciences. 2021;22(11)  PubMed
Loubalova, Zuzana; Fulka, Helena; Horvat, Filip; Pasulka, Josef; Malik, Radek; Hirose, Michiko; Ogura, Atsuo; Svoboda, Petr. Formation of spermatogonia and fertile oocytes in golden hamsters requires piRNAs. Nature Cell Biology. 2021;23(9):992-1001.  PubMed
Wasim, Muhammad; Carlet, Michela; Mansha, Muhammad; Greil, Richard; Ploner, Christian; Trockenbacher, Alexander; Rainer, Johannes; Kofler, Reinhard. PLZF/ZBTB16, a glucocorticoid response gene in acute lymphoblastic leukemia, interferes with glucocorticoid-induced apoptosis. The Journal Of Steroid Biochemistry And Molecular Biology. 2010;120(4-5):218-27.  PubMed
Nakata, Hiroki; Wakayama, Tomohiko; Takai, Yoshimi; Iseki, Shoichi. Quantitative analysis of the cellular composition in seminiferous tubules in normal and genetically modified infertile mice. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2015;63(2):99-113.  PubMed
Del Vento, Federico; Vermeulen, Maxime; Ucakar, Bernard; Poels, Jonathan; des Rieux, Anne; Wyns, Christine. Significant Benefits of Nanoparticles Containing a Necrosis Inhibitor on Mice Testicular Tissue Autografts Outcomes. International Journal Of Molecular Sciences. 2019;20(23)  PubMed
Nakata, Hiroki; Nakano, Taito; Iseki, Shoichi; Mizokami, Atsushi. Three-Dimensional Analysis of Busulfan-Induced Spermatogenesis Disorder in Mice. Frontiers In Cell And Developmental Biology. 8( 33392198):609278.  PubMed