Anti ZBED4 pAb (ATL-HPA045341)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045341-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ZBED4
Alternative Gene Name: KIAA0637
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034333: 81%, ENSRNOG00000004588: 81%
Entrez Gene ID: 9889
Uniprot ID: O75132
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPDSLERMDFKSEQEDMKQTDSGGERAGLGGTGCSCKPPGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPAWKHFFISPRDSTKAICMYCVKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQ |
Gene Sequence | PPDSLERMDFKSEQEDMKQTDSGGERAGLGGTGCSCKPPGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPAWKHFFISPRDSTKAICMYCVKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQ |
Gene ID - Mouse | ENSMUSG00000034333 |
Gene ID - Rat | ENSRNOG00000004588 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZBED4 pAb (ATL-HPA045341) | |
Datasheet | Anti ZBED4 pAb (ATL-HPA045341) Datasheet (External Link) |
Vendor Page | Anti ZBED4 pAb (ATL-HPA045341) at Atlas Antibodies |
Documents & Links for Anti ZBED4 pAb (ATL-HPA045341) | |
Datasheet | Anti ZBED4 pAb (ATL-HPA045341) Datasheet (External Link) |
Vendor Page | Anti ZBED4 pAb (ATL-HPA045341) |