Anti YY1 pAb (ATL-HPA001119)

Atlas Antibodies

Catalog No.:
ATL-HPA001119-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: YY1 transcription factor
Gene Name: YY1
Alternative Gene Name: DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021264: 100%, ENSRNOG00000004339: 100%
Entrez Gene ID: 7528
Uniprot ID: P25490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH
Gene Sequence DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH
Gene ID - Mouse ENSMUSG00000021264
Gene ID - Rat ENSRNOG00000004339
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YY1 pAb (ATL-HPA001119)
Datasheet Anti YY1 pAb (ATL-HPA001119) Datasheet (External Link)
Vendor Page Anti YY1 pAb (ATL-HPA001119) at Atlas Antibodies

Documents & Links for Anti YY1 pAb (ATL-HPA001119)
Datasheet Anti YY1 pAb (ATL-HPA001119) Datasheet (External Link)
Vendor Page Anti YY1 pAb (ATL-HPA001119)
Citations for Anti YY1 pAb (ATL-HPA001119) – 5 Found
Kaufhold, Samantha; Garbán, Hermes; Bonavida, Benjamin. Yin Yang 1 is associated with cancer stem cell transcription factors (SOX2, OCT4, BMI1) and clinical implication. Journal Of Experimental & Clinical Cancer Research : Cr. 2016;35( 27225481):84.  PubMed
Patten, Darren K; Corleone, Giacomo; Győrffy, Balázs; Perone, Ylenia; Slaven, Neil; Barozzi, Iros; Erdős, Edina; Saiakhova, Alina; Goddard, Kate; Vingiani, Andrea; Shousha, Sami; Pongor, Lőrinc Sándor; Hadjiminas, Dimitri J; Schiavon, Gaia; Barry, Peter; Palmieri, Carlo; Coombes, Raul C; Scacheri, Peter; Pruneri, Giancarlo; Magnani, Luca. Enhancer mapping uncovers phenotypic heterogeneity and evolution in patients with luminal breast cancer. Nature Medicine. 2018;24(9):1469-1480.  PubMed
Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300.  PubMed
Bevelacqua, Valentina; Bevelacqua, Ylenia; Candido, Saverio; Skarmoutsou, Evangelia; Amoroso, Alfredo; Guarneri, Claudio; Strazzanti, Angela; Gangemi, Pietro; Mazzarino, Maria C; D'Amico, Fabio; McCubrey, James A; Libra, Massimo; Malaponte, Grazia. Nectin like-5 overexpression correlates with the malignant phenotype in cutaneous melanoma. Oncotarget. 2012;3(8):882-92.  PubMed
Xu, Chenxi; Tsai, Yi-Hsuan; Galbo, Phillip M; Gong, Weida; Storey, Aaron J; Xu, Yuemei; Byrum, Stephanie D; Xu, Lingfan; Whang, Young E; Parker, Joel S; Mackintosh, Samuel G; Edmondson, Ricky D; Tackett, Alan J; Huang, Jiaoti; Zheng, Deyou; Earp, H Shelton; Wang, Gang Greg; Cai, Ling. Cistrome analysis of YY1 uncovers a regulatory axis of YY1:BRD2/4-PFKP during tumorigenesis of advanced prostate cancer. Nucleic Acids Research. 2021;49(9):4971-4988.  PubMed