Anti YWHAE pAb (ATL-HPA008445)

Atlas Antibodies

Catalog No.: ATL-HPA008445-25

Protein Description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon
Gene Name: YWHAE
Alternative Gene Name: FLJ45465
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020849: 100%, ENSRNOG00000005290: 100%
Entrez Gene ID: 7531
Uniprot ID: P62258
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE
• Gene Sequence: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE
• Gene ID - Mouse: ENSMUSG00000020849
• Gene ID - Rat: ENSRNOG00000005290
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti YWHAE pAb (ATL-HPA008445) – 1 Found

Lee, Cheng-Han; Ou, Wen-Bin; Mariño-Enriquez, Adrian; Zhu, Meijun; Mayeda, Mark; Wang, Yuexiang; Guo, Xiangqian; Brunner, Alayne L; Amant, Frédéric; French, Christopher A; West, Robert B; McAlpine, Jessica N; Gilks, C Blake; Yaffe, Michael B; Prentice, Leah M; McPherson, Andrew; Jones, Steven J M; Marra, Marco A; Shah, Sohrab P; van de Rijn, Matt; Huntsman, David G; Dal Cin, Paola; Debiec-Rychter, Maria; Nucci, Marisa R; Fletcher, Jonathan A. 14-3-3 fusion oncogenes in high-grade endometrial stromal sarcoma. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2012;109(3):929-34.