Anti YES1 pAb (ATL-HPA026480)

Atlas Antibodies

Catalog No.: ATL-HPA026480-25

Protein Description: YES proto-oncogene 1, Src family tyrosine kinase
Gene Name: YES1
Alternative Gene Name: c-yes, HsT441, Yes
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014932: 70%, ENSRNOG00000037227: 63%
Entrez Gene ID: 7525
Uniprot ID: P07947
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLS
• Gene Sequence: KSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLS
• Gene ID - Mouse: ENSMUSG00000014932
• Gene ID - Rat: ENSRNOG00000037227
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti YES1 pAb (ATL-HPA026480) – 1 Found

Hiebel, Christof; Stürner, Elisabeth; Hoffmeister, Meike; Tascher, Georg; Schwarz, Mario; Nagel, Heike; Behrends, Christian; Münch, Christian; Behl, Christian. BAG3 Proteomic Signature under Proteostasis Stress. Cells. 2020;9(11)