Anti YARS2 pAb (ATL-HPA057610)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057610-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: YARS2
Alternative Gene Name: CGI-04, FLJ13995, mt-TyrRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022792: 91%, ENSRNOG00000025252: 90%
Entrez Gene ID: 51067
Uniprot ID: Q9Y2Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FTVLDNSAWYQKQHLVDFLAAVGGHFRMGTLLSRQSVQLRLKSPEGMSLAEFFYQVLQAYDFYYLFQRYGCRVQLGGSDQLGNIMSGYEFINKL |
Gene Sequence | FTVLDNSAWYQKQHLVDFLAAVGGHFRMGTLLSRQSVQLRLKSPEGMSLAEFFYQVLQAYDFYYLFQRYGCRVQLGGSDQLGNIMSGYEFINKL |
Gene ID - Mouse | ENSMUSG00000022792 |
Gene ID - Rat | ENSRNOG00000025252 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti YARS2 pAb (ATL-HPA057610) | |
Datasheet | Anti YARS2 pAb (ATL-HPA057610) Datasheet (External Link) |
Vendor Page | Anti YARS2 pAb (ATL-HPA057610) at Atlas Antibodies |
Documents & Links for Anti YARS2 pAb (ATL-HPA057610) | |
Datasheet | Anti YARS2 pAb (ATL-HPA057610) Datasheet (External Link) |
Vendor Page | Anti YARS2 pAb (ATL-HPA057610) |