Anti XRCC6 pAb (ATL-HPA047549 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047549-25
  • Immunohistochemical staining of human fallopian tube, kidney, lymphoid tissues and testis using Anti-XRCC6 antibody HPA047549 (A) shows similar protein distribution across tissues to independent antibody HPA062226 (B).
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
  • Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-XRCC6 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 6
Gene Name: XRCC6
Alternative Gene Name: D22S671, D22S731, G22P1, KU70, ML8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022471: 85%, ENSRNOG00000006392: 87%
Entrez Gene ID: 2547
Uniprot ID: P12956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL
Gene Sequence PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL
Gene ID - Mouse ENSMUSG00000022471
Gene ID - Rat ENSRNOG00000006392
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti XRCC6 pAb (ATL-HPA047549 w/enhanced validation)
Datasheet Anti XRCC6 pAb (ATL-HPA047549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti XRCC6 pAb (ATL-HPA047549 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti XRCC6 pAb (ATL-HPA047549 w/enhanced validation)
Datasheet Anti XRCC6 pAb (ATL-HPA047549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti XRCC6 pAb (ATL-HPA047549 w/enhanced validation)