Anti XKR7 pAb (ATL-HPA040854)

Atlas Antibodies

Catalog No.:
ATL-HPA040854-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: XK, Kell blood group complex subunit-related family, member 7
Gene Name: XKR7
Alternative Gene Name: C20orf159, dJ310O13.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042631: 89%, ENSRNOG00000009180: 91%
Entrez Gene ID: 343702
Uniprot ID: Q5GH72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGPMLGPQAPGCIFRKASEPCGPPADAITSPPRSLPRTTGAERDGASAGERAGTPTPPVFQVRPGLPPTPVARTLRTEGPVIRIDLPRK
Gene Sequence NGPMLGPQAPGCIFRKASEPCGPPADAITSPPRSLPRTTGAERDGASAGERAGTPTPPVFQVRPGLPPTPVARTLRTEGPVIRIDLPRK
Gene ID - Mouse ENSMUSG00000042631
Gene ID - Rat ENSRNOG00000009180
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XKR7 pAb (ATL-HPA040854)
Datasheet Anti XKR7 pAb (ATL-HPA040854) Datasheet (External Link)
Vendor Page Anti XKR7 pAb (ATL-HPA040854) at Atlas Antibodies

Documents & Links for Anti XKR7 pAb (ATL-HPA040854)
Datasheet Anti XKR7 pAb (ATL-HPA040854) Datasheet (External Link)
Vendor Page Anti XKR7 pAb (ATL-HPA040854)