Anti XKR4 pAb (ATL-HPA025072)

Atlas Antibodies

Catalog No.:
ATL-HPA025072-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: XK, Kell blood group complex subunit-related family, member 4
Gene Name: XKR4
Alternative Gene Name: KIAA1889
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051951: 85%, ENSRNOG00000027276: 87%
Entrez Gene ID: 114786
Uniprot ID: Q5GH76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPSTPQRQASNASKSNIAAANSGSNSSGATRASGKHRS
Gene Sequence FVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPSTPQRQASNASKSNIAAANSGSNSSGATRASGKHRS
Gene ID - Mouse ENSMUSG00000051951
Gene ID - Rat ENSRNOG00000027276
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XKR4 pAb (ATL-HPA025072)
Datasheet Anti XKR4 pAb (ATL-HPA025072) Datasheet (External Link)
Vendor Page Anti XKR4 pAb (ATL-HPA025072) at Atlas Antibodies

Documents & Links for Anti XKR4 pAb (ATL-HPA025072)
Datasheet Anti XKR4 pAb (ATL-HPA025072) Datasheet (External Link)
Vendor Page Anti XKR4 pAb (ATL-HPA025072)