Anti XKR4 pAb (ATL-HPA025072)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025072-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: XKR4
Alternative Gene Name: KIAA1889
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051951: 85%, ENSRNOG00000027276: 87%
Entrez Gene ID: 114786
Uniprot ID: Q5GH76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPSTPQRQASNASKSNIAAANSGSNSSGATRASGKHRS |
| Gene Sequence | FVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPSTPQRQASNASKSNIAAANSGSNSSGATRASGKHRS |
| Gene ID - Mouse | ENSMUSG00000051951 |
| Gene ID - Rat | ENSRNOG00000027276 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti XKR4 pAb (ATL-HPA025072) | |
| Datasheet | Anti XKR4 pAb (ATL-HPA025072) Datasheet (External Link) |
| Vendor Page | Anti XKR4 pAb (ATL-HPA025072) at Atlas Antibodies |
| Documents & Links for Anti XKR4 pAb (ATL-HPA025072) | |
| Datasheet | Anti XKR4 pAb (ATL-HPA025072) Datasheet (External Link) |
| Vendor Page | Anti XKR4 pAb (ATL-HPA025072) |