Anti XKR3 pAb (ATL-HPA003379)

Atlas Antibodies

Catalog No.:
ATL-HPA003379-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: XK, Kell blood group complex subunit-related family, member 3
Gene Name: XKR3
Alternative Gene Name: MGC57211, XTES
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022672: 29%, ENSRNOG00000004217: 31%
Entrez Gene ID: 150165
Uniprot ID: Q5GH77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAFK
Gene Sequence TIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAFK
Gene ID - Mouse ENSMUSG00000022672
Gene ID - Rat ENSRNOG00000004217
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XKR3 pAb (ATL-HPA003379)
Datasheet Anti XKR3 pAb (ATL-HPA003379) Datasheet (External Link)
Vendor Page Anti XKR3 pAb (ATL-HPA003379) at Atlas Antibodies

Documents & Links for Anti XKR3 pAb (ATL-HPA003379)
Datasheet Anti XKR3 pAb (ATL-HPA003379) Datasheet (External Link)
Vendor Page Anti XKR3 pAb (ATL-HPA003379)