Anti WWC1 pAb (ATL-HPA038017)

Atlas Antibodies

Catalog No.:
ATL-HPA038017-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: WW and C2 domain containing 1
Gene Name: WWC1
Alternative Gene Name: KIAA0869, KIBRA, PPP1R168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018849: 75%, ENSRNOG00000008065: 76%
Entrez Gene ID: 23286
Uniprot ID: Q8IX03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPCSPLMADPLLAGDAFLNSLEFEDPELSATLCELSLGNSAQERYRLEEPGTEGKQLGQAVNTAQGC
Gene Sequence PPCSPLMADPLLAGDAFLNSLEFEDPELSATLCELSLGNSAQERYRLEEPGTEGKQLGQAVNTAQGC
Gene ID - Mouse ENSMUSG00000018849
Gene ID - Rat ENSRNOG00000008065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WWC1 pAb (ATL-HPA038017)
Datasheet Anti WWC1 pAb (ATL-HPA038017) Datasheet (External Link)
Vendor Page Anti WWC1 pAb (ATL-HPA038017) at Atlas Antibodies

Documents & Links for Anti WWC1 pAb (ATL-HPA038017)
Datasheet Anti WWC1 pAb (ATL-HPA038017) Datasheet (External Link)
Vendor Page Anti WWC1 pAb (ATL-HPA038017)